DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and AT1G20760

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:NP_173499.1 Gene:AT1G20760 AraportID:AT1G20760 Length:1019 Species:Arabidopsis thaliana

Alignment Length:1229 Identity:257/1230 (21%)
Similarity:411/1230 (33%) Gaps:444/1230 (36%)


  Fly    16 YEAYYKLIDPKGTGAIEAMTAAKFLKKSGLSDVVLSRIWDLSDPSGKGFLDKPGFFVALKLVSLS 80
            :|||:|..|..|.|.|....|..|.:.||||..||::||.|||.|..||||:..|:.:|:||:::
plant    11 FEAYFKRADLDGDGRISGAEAVGFFQGSGLSKQVLAQIWSLSDRSHSGFLDRQNFYNSLRLVTVA 75

  Fly    81 QAGQVASMANIYLDIAN------------PPK--LGELPKTMPSRIQTV--PVASGGVANGDWSI 129
            |     |..::..:|.|            |||  |..:|...|:...|.  ||:..|   |..:.
plant    76 Q-----SKRDLTPEIVNAALNTPAAAKIPPPKINLSAIPAPRPNPAATTVGPVSGFG---GPGAP 132

  Fly   130 GVIDRLKY--EQLFESLHPSNGMLPGNKVKGVLMDSKLPMSILGTIWDLADQDKDGNLDMHEFVV 192
            ..|....|  .|..:.:.|:.|:.....::........|.::.|                     
plant   133 NAIVNQNYFPPQQNQQMRPNQGISGLTSLRPAAGPEYRPSALSG--------------------- 176

  Fly   193 AMHLVYQTLQKRTIP--SVLPPELRKPGGAGPPPKPAMPPPP-----------AGAAMPRAPSGE 244
                     |.:.:|  ||..|         |.|.|.....|           |||......| .
plant   177 ---------QFQPVPVGSVTHP---------PQPVPTSVSGPGSSTFNLNSLYAGAGNTSGYS-S 222

  Fly   245 GFGDGGFVANFP-----KDIAPPA-----------------------------AIPPLPVAVPPM 275
            |||.|...|..|     ..|.|.|                             ||.|....:.|.
plant   223 GFGGGSLAAPSPGLKQESHIDPKALVVSGNGGDMFSSFQQKQEPTLSNSSISSAIVPTSAGIQPP 287

  Fly   276 TR-------------IP-------PVGAVSSQPLIQTD-PL--IPIGAPVMA---------NADW 308
            |:             :|       |..|.||||.:.:. |.  :|.|:.|.:         ...|
plant   288 TKPNALDSLQSTFSMLPSGNQLQQPRPAASSQPAVSSQGPSSGLPPGSAVGSGHSTPAGNNQPPW 352

  Fly   309 -VVTPADLKRFEEIFRQSDLDKDGLVSGLEVKDIFIKSGIPQRSLADIWALCDTNQSGKLTVEQF 372
             .:.|:|::::.::|.:.|.||||.::|.:.:::|:...:|:..|..:|.|.|.:....|::.:|
plant   353 PKMKPSDVQKYTKVFMEVDSDKDGKITGEQARNLFLSWRLPREVLKHVWELSDQDNDTMLSLREF 417

  Fly   373 ALAMWFVERKQRGVDPPHVLNANMVPPSMRATVAGVD----------------LQP----QEVKP 417
            .::::.:||.:.|...|..|.::::......:::|..                .||    :.:.|
plant   418 CISLYLMERYREGRPLPTALPSSIMFDETLLSISGAPSHGYANAGWGSGQGFVQQPGMGARPITP 482

  Fly   418 TYS-NPELEMISKE------IEELARERRVLETEIAQKEADVRIKNGEVRSLQSELDTLTATLKQ 475
            |.. .|.:.....:      ..:...:..||:...|.     .:.||  .|..|.|....|.   
plant   483 TTGMRPPVPAPGPQPGSGIPPNQPRNQAPVLDAPFAN-----HLGNG--YSASSNLPEAAAD--- 537

  Fly   476 LENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQCHMQEVTINEQEGELNAKR 540
             |.:..|.|....|.:.::.:....:.::.|..||.:.::.:|.::     .:.:::|.|..||:
plant   538 -EEKVDEKQNAYMDSREKLDYYRTKMQDIVLYKSRCDNRLNEISER-----ASADKREAETLAKK 596

  Fly   541 SELQ---------KLKDEEASLQKEYDSNNRELSKLTNHLQ-------ATQLQISSVRSMVTQLL 589
            .|.:         ||..|||.. :|.:....|||:...:::       ..|::...::|.:.:|:
plant   597 YEEKYKQVAEIGSKLTIEEARF-REIEGRKMELSQAIVNMEQGGSADGLLQVRADRIQSDLEELM 660

  Fly   590 E--TQRQMTDALLICRAAMENQNAELVSEYQLKIEPDFDEARKTLTKEVQLPKDDPF-------- 644
            :  |:|        |:......|::.:.:.....:|...|......:|....:|:.|        
plant   661 KALTER--------CKKHGLEVNSKALVDLPAGWQPGIQEGAALWDEEWDKFEDEGFGNEITFDK 717

  Fly   645 --EENNSGAANQATNGFGS-------------DPFS----------------------GQPVNK- 671
              |:|:||.....|...||             .|||                      ..||:: 
plant   718 SKEQNSSGEKENGTVDDGSGPPDSPTHVEDNYGPFSETSDRHHESEYGTTHSEDRSPRDSPVSRN 782

  Fly   672 ------PAISTG-----FDDSFNMSSGFDS--------GFDAF-GQSGAGSAFGQTQRDPFGSDA 716
                  |..|.|     |||| |.:|.||:        ||||. .|.|          |.|||. 
plant   783 ATEVPSPDYSQGKNSEFFDDS-NWASAFDTNDDVDSVWGFDASKSQDG----------DYFGSG- 835

  Fly   717 FAANKSNAITPEPGKDDFGSDPFAALHAPTGQGQVLSPNAQKSGPPPRPESPSPALPPKKSKVPP 781
                           ||||                        |...|.:|||            
plant   836 ---------------DDFG------------------------GNTARADSPS------------ 849

  Fly   782 PRPAPPRAAQPTGGFGSGGGGGFADFDDFDNKLHHIPSAPSPSATALSPLPPTLPAPIPVVSGSS 846
                       :..||:.....|| |||         |.||...:.....||..       |.:|
plant   850 -----------SRSFGAQRKSQFA-FDD---------SVPSTPLSRFGNSPPRF-------SDAS 886

  Fly   847 L----LDSFTLFDDPGQIHKQAASTPNPTPITVPTVHTLLQTSLSTPAAPSPALASLSTSGSGSV 907
            .    .|||:.||                                          |.:|    |.
plant   887 ARDNNFDSFSRFD------------------------------------------SFNT----SE 905

  Fly   908 AGAG-ADLPSSV----TITTAPSLNNQHLSRSNTPLQNQRTADVKLETKAVVSVFDAFGEIGTRK 967
            |||| :..|..:    :|.::........||.:: :.:.|  ||....|     |..|..|.:.|
plant   906 AGAGFSSQPERLSRFDSINSSKDFGGAAFSRFDS-INSSR--DVTGAEK-----FSRFDSINSSK 962

  Fly   968 -APTPSL-----ITGPTDFKDDPFKDYRYEDPFSIKDPFAEEGEEELSEGKGADHKRNF 1020
             ...|||     :....||.......:...|||....||....:|  |..|.:|:..:|
plant   963 DFGGPSLSRFDSMNSTKDFSGSHGYSFDDADPFGSTGPFKVSSDE--SPTKRSDNWNSF 1019

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009 31/66 (47%)
EH 126..215 CDD:197477 12/93 (13%)
EH 137..202 CDD:238009 6/67 (9%)
EH 307..402 CDD:197477 23/96 (24%)
EH 318..384 CDD:238009 17/66 (26%)
RILP-like <445..548 CDD:304877 22/112 (20%)
Spc24 529..>584 CDD:285486 16/71 (23%)
AT1G20760NP_173499.1 EH 11..77 CDD:238009 31/71 (44%)
EH 351..441 CDD:197477 23/90 (26%)
EH 363..429 CDD:238009 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1594
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
44.150

Return to query results.
Submit another query.