DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and pan1

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:NP_001342822.1 Gene:pan1 PomBaseID:SPAC25G10.09c Length:1794 Species:Schizosaccharomyces pombe

Alignment Length:1085 Identity:212/1086 (20%)
Similarity:375/1086 (35%) Gaps:316/1086 (29%)


  Fly   206 IPSVLPPELRKPGGAGP--PPKPAMPPPPAGAAMPRAPSGEGFGDGGFVANFPKDIAP------- 261
            :|.:..|...:..|..|  |.:..|.|...|...|.||...|.          :.:||       
pombe   694 MPGMQQPMAPQRTGMQPMMPQRTGMQPQMPGMQQPMAPQRTGM----------QPMAPQRTGMQP 748

  Fly   262 -----------PAAIPPLPVAVP--------PMTRIPPVGAVSSQPLIQTDPLIPIGA-----PV 302
                       ...:.|.|..:|        |::.:|.:.|:..|.:    |..|.|.     ..
pombe   749 QMTGGPMLPQRTGGMAPQPTGMPGQWGFINTPLSNLPGIEALGQQMM----PNAPSGGLNNTFQQ 809

  Fly   303 MANADWVVTPADLKRFEEIFRQSDLDKDGLVSGLEVKDIFIKSGIPQRSLADIWALCDTNQSGKL 367
            ..:..|.::..:.:.:::||...|.::.|.:.|..|.:||.:|.:.:..|..||.|||....|.|
pombe   810 KKDIPWAISKEEKRIYDQIFDAWDKERKGTLGGNAVLEIFGQSKLTRTELEHIWNLCDHGDKGSL 874

  Fly   368 TVEQFALAMWFVERKQRGVDPPHVLNANMVPPSMRATVA-------------------GVDLQPQ 413
            ..::||:|:..:.||..|.:.|.||...::|||.|....                   |.:.|.:
pombe   875 DRDEFAVALHLIYRKLNGNEVPAVLPPELIPPSTRNFTESLNQVKNLIKNDTSNRKPFGAENQSK 939

  Fly   414 EVKPT-YSNPELEMISKEIE-------------ELARERRVLETEIAQKEADVRIKNGEVRSLQS 464
            ..|.: |.||. |...|:..             ..||.|...|.:|......:...:.|:.||:.
pombe   940 LKKNSFYDNPS-ETTEKDATLYRHNDSDASAYVSSARRRDFKEEKIESAPPIINDIDSEIASLKK 1003

  Fly   465 ELDTLTATLKQLENQR------GEAQK-----RLDDLQAQVSHNTAVLANVSLDISRTNEQVTKI 518
            .:...:..:..||:::      .:.|.     |:..:|.::  |....:|.|.:::..|.::.::
pombe  1004 RIHEKSLVVNALEDKKLAATPANDVQNDSLIYRIKSVQDEI--NRLSTSNKSPEVASMNVRLEEL 1066

  Fly   519 RDQCHMQEVTINEQEGELNAKRSELQKLKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRS 583
            ..:.......|||.:..:.:...:|.:.:|.:.|    ||..:.|.::..|            |:
pombe  1067 STRVSKMLSDINEVDHTIASLSLKLFQAEDTKNS----YDQTSPEATQERN------------RT 1115

  Fly   584 MVTQLLETQRQMTDALLICRAAME---NQNAELVSEYQLKIEPD------------FDEARKTLT 633
            :.::|.|.::|..::    :||:|   |....:.:..:.|:.|.            .||:...:.
pombe  1116 ISSKLAEMEKQKNES----KAALEQMKNYVTNIENNIRAKLLPSAANDDAWLSQNVVDESVTRVV 1176

  Fly   634 KEVQLP-----------------KDDPFEENNSGAANQATNGFGSDPFSGQPVNKPAISTGFDD- 680
            ||:.:|                 :..|.|.|......:||:            ..|:.|:..:| 
pombe  1177 KELPVPAPAAPQTLNPPSVSTVQQSKPIESNTHTPEVKATS------------ESPSASSNLEDR 1229

  Fly   681 ----SFNMSSGFDSGFDAFG----QSGAGS------------AFGQTQRDPFGSDAFAANK---- 721
                ........:....|.|    |.|..|            |....|:...|..|.|.:.    
pombe  1230 AARIKAEAQRRMNERLAALGIKPRQKGTPSPAPVNSATSTPVAAPTAQQIQPGKQASAVSSNVPA 1294

  Fly   722 -SNAIT-----------PEPGKDDFGSDPFAALH-----------APTGQGQVLSPNAQKSG--P 761
             |.:|:           |:|.|    ..|.||:.           ||..|...|.....|..  |
pombe  1295 VSASISTPPAVVPTVQHPQPTK----QIPTAAVKDPSTTSTSFNTAPIPQQAPLENQFSKMSLEP 1355

  Fly   762 PPR---PESPSPALPPKKSKVPPPRPAPPRAAQPT--------------GGFGS-GGGGGFADFD 808
            |.|   |.||.|.:|...:...||.|..|..|.|:              ..||| ..|...:..:
pombe  1356 PVRPAVPTSPKPQIPDSSNVHAPPPPVQPMNAMPSHNAVNARPSAPERRDSFGSVSSGSNVSSIE 1420

  Fly   809 DFDNKL--------------HH----IPSAP----------SPSATALSPLPPTLPAPIPVVSGS 845
            |..:.:              :|    :|.||          :|.....:|.|.:.|||       
pombe  1421 DETSTMPLKASQPTNPGAPSNHAPQVVPPAPMHAVAPVQPKAPGMVTNAPAPSSAPAP------- 1478

  Fly   846 SLLDSFTLFDDPGQIHKQAASTPN-PTPITVPTVHTLLQTSLSTPAAPSPALASLSTSGS--GSV 907
                       |..:.:...:.|| |.|..:|:|.....:|::...|||..|....:|.:  .|.
pombe  1479 -----------PAPVSQLPPAVPNVPVPSMIPSVAQQPPSSVAPATAPSSTLPPSQSSFAHVPSP 1532

  Fly   908 AGAGADLPSSVTITTAPSLNNQHLSRSNTPLQNQRTADVKLETKAVVSVFDAFGEIGTRKAPTPS 972
            |......||:..:::||:.|:  :...::|...|....   :.:|:.::..| ..:||.::.:|.
pombe  1533 APPAPQHPSAAALSSAPADNS--MPHRSSPYAPQEPVQ---KPQAINNIAPA-TNLGTSQSFSPR 1591

  Fly   973 LITGPTDFKDDPF-----------------KDYRYEDPFS-----IKDPFAEEGEEELSEGKGAD 1015
            :  ||.:....|.                 ....:.:||:     ...|....|.:..:..:..|
pombe  1592 M--GPVNNSGSPLAMNAAGQPSLAVPAVPSAPSNHFNPFAKMQPPAPSPLQPSGHDSDNWSQHGD 1654

  Fly  1016 HKRNFAED--FSSGDEIGSAAKTLSNI-----VNNNSIKPKAATP 1053
            .:...:||  .||.|....|||....:     |:...::|::|.|
pombe  1655 EEEEDSEDDIRSSKDAAALAAKLFGGMAPAHPVSTPPVRPQSAAP 1699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009
EH 126..215 CDD:197477 2/9 (22%)
EH 137..202 CDD:238009
EH 307..402 CDD:197477 30/95 (32%)
EH 318..384 CDD:238009 22/66 (33%)
RILP-like <445..548 CDD:304877 17/114 (15%)
Spc24 529..>584 CDD:285486 11/55 (20%)
pan1NP_001342822.1 DUF1720 177..262 CDD:311924
EH 276..368 CDD:197477
DUF1720 422..508 CDD:311924
Med15 473..>796 CDD:312941 21/116 (18%)
EH 814..909 CDD:197477 30/95 (32%)
SMC_N <976..>1150 CDD:330553 33/196 (17%)
Atrophin-1 <1180..1637 CDD:331285 93/499 (19%)
WH2 1746..1772 CDD:308040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.