DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and eps15l1a

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:XP_009294589.1 Gene:eps15l1a ZFINID:ZDB-GENE-060503-274 Length:943 Species:Danio rerio

Alignment Length:952 Identity:307/953 (32%)
Similarity:448/953 (47%) Gaps:225/953 (24%)


  Fly    15 VYEAYYKLIDPKGTGAIEAMTAAKFLKKSGLSDVVLSRIWDLSDPSGKGFLDKPGFFVALKLVSL 79
            |||.:|:.:||..||.:....||.|||||||.|:.|.:||||:||.|||||||.||:|||:||:.
Zfish    16 VYENFYRQVDPGNTGRVGPTEAALFLKKSGLPDITLGKIWDLADPDGKGFLDKQGFYVALRLVAC 80

  Fly    80 SQAGQVASMANIYLDIANP-------PKLGELPKTMPSRIQTVPVASGGVANGDWSIGVIDRLKY 137
            :|:|...|::::.|.:..|       |.|..:..|..|.               |::...::.|:
Zfish    81 AQSGHDISISSLNLPVPPPKFKDHSSPSLSSVTSTNESH---------------WAVRPEEKSKF 130

  Fly   138 EQLFESLHPSNGMLPGNKVKGVLMDSKLPMSILGTIWDLADQDKDGNLDMHEFVVAMHLVYQTLQ 202
            :.:||||.|.||:|.|.|||.||::||||:.:||.:|||:|.||||:||..||.|||||||:.|:
Zfish   131 DGIFESLAPVNGLLSGEKVKPVLINSKLPVDVLGKVWDLSDIDKDGHLDRDEFAVAMHLVYRALE 195

  Fly   203 KRTIPSVL-----PPELRKPGGAG----PPPKPAMPPPPAGAAMPRAPSGEGFGDGGFVANFPKD 258
            |..:||||     ||..||.....    .|..|..||||..:.......|.              
Zfish   196 KEPVPSVLPSSLIPPSKRKKSSGSLSSMVPVLPGSPPPPKDSLRSTPSHGS-------------- 246

  Fly   259 IAPPAAIPPLPVAVPPMTRIPPVGAVSSQPLIQTDPLIPIGAPVMANADWVVTPADLKRFEEIFR 323
                            |..:...|::|.:..:::.         ..:.:|||..||..|:::||.
Zfish   247 ----------------MNSLNSAGSLSPKHTLKSS---------QHSVNWVVPVADRGRYDDIFL 286

  Fly   324 QSDLDKDGLVSGLEVKDIFIKSGIPQRSLADIWALCDTNQSGKLTVEQFALAMWFVERK-QRGVD 387
            ::|.|.||.||||||||||::||:.|..||.||||.||.|.||||.|||:|||:.:::| .:|:|
Zfish   287 KTDSDLDGFVSGLEVKDIFMQSGLHQNLLAHIWALADTRQMGKLTREQFSLAMYLIQQKVSKGLD 351

  Fly   388 PPHVLNANMVPPSMRATVAGVDLQPQEVKPTYSNP------------------------------ 422
            ||..|..:|:|||.|.|       |......|..|                              
Zfish   352 PPQALTPDMIPPSERGT-------PGPSLSGYMTPVGSDMAALTEMRRAIMFKLWDSSSSVGSGE 409

  Fly   423 -----ELEMISKEIEEL-----------ARERRVLETEIAQKEADVRIKNGEVRSLQSELDTLTA 471
                 ||:.||:||.:|           .||:..||.:|.:.|..:|.|..||:.:|::||..|:
Zfish   410 FTGIKELDDISQEIAQLQSTLAFTHWDTLREKYTLEQDIRETEEAIRHKTTEVQEMQNDLDRETS 474

  Fly   472 TLKQLENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQCHMQEVTINEQEGEL 536
            :|::||.|:.:||.||:::..|.:....:|.:|.......::.::.::.|.|.||..:..||.||
Zfish   475 SLQELEAQKQDAQDRLEEMDQQKAKLEDMLNDVRQKCQEESQMISSLQTQIHSQESDLQSQEEEL 539

  Fly   537 NAKRSELQKLKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRSMVTQLLETQRQ------- 594
            ...:::|.:|:.|||.|::...:...:|..:...|:|||.:|:..||.::|:.::|.:       
Zfish   540 GRAKADLNRLQQEEAQLEQSLQAGRIQLETIIKSLKATQDEINQARSKLSQIQDSQHEISKNIEQ 604

  Fly   595 ------------MTDALLICRAAMENQNAEL-VSEYQLKIEPD-FDEARKTL-TKEVQLP---KD 641
                        ||:...:.....|.:|... ..|...|::|. |:.|.:.: |...|..   |.
Zfish   605 YSSTLNGTHGGSMTNLADMSEGFPEKENGGFGAMEDPFKVKPTVFNSAPQEMHTDPFQSEDPFKT 669

  Fly   642 DPFEENNSGAANQATNGF---GSDPFSGQPVNKPAIST----GFD-----DSFNMSSGFDSGFDA 694
            |||:|      .:.:|.|   |.|||...|.:|||.:.    |.|     |.|..||.     |.
Zfish   670 DPFKE------ERLSNRFVKSGGDPFQNDPFSKPATTVPDPFGGDPFKETDPFRTSSE-----DF 723

  Fly   695 FGQSGAGSAFGQTQRDPFGSDAFAANKSN---------AITPEP-GKDDFGS-DPFA-------- 740
            |.:......|  |..|||...|...:||:         :.:|:| |:|.||: |||.        
Zfish   724 FKKPSKPDPF--TNADPFSKSATLPSKSHHFASNDPFISTSPKPKGQDFFGTLDPFGSSTFGSNS 786

  Fly   741 --ALHAPTGQGQVLSPNAQKSGPPPRPESPSPALPPKKSKVPPPRPAPPRA-AQPTGGFGSGGGG 802
              |..:...:|.|..|.::|        ...||||||||  .||||.||.. :.|....|||...
Zfish   787 GFADFSQMSKGFVEDPFSRK--------QDMPALPPKKS--IPPRPKPPSGKSTPVNVPGSGDPA 841

  Fly   803 GFAD-------------------FDDFDNKLHHIPSAPSPSA 825
            ..:|                   .|.|..|....|||||.::
Zfish   842 KTSDPFQPFSADPVDPFQCKKGVGDPFSGKDPFAPSAPSKAS 883

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009 39/66 (59%)
EH 126..215 CDD:197477 49/94 (52%)
EH 137..202 CDD:238009 40/65 (62%)
EH 307..402 CDD:197477 54/96 (56%)
EH 318..384 CDD:238009 39/67 (58%)
RILP-like <445..548 CDD:304877 31/103 (30%)
Spc24 529..>584 CDD:285486 18/55 (33%)
eps15l1aXP_009294589.1 EF-hand_4 11..101 CDD:332633 44/85 (52%)
EH 120..213 CDD:197477 49/93 (53%)
EH 270..366 CDD:197477 54/96 (56%)
SMC_N 414..>610 CDD:330553 56/196 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0998
Hieranoid 1 1.000
Homologene 1 1.000 H31881
Inparanoid 1 1.050 415 1.000 Inparanoid score I1759
OMA 1 1.010
OrthoDB 1 1.010 D360276at33208
OrthoFinder 1 1.000 FOG0000866
OrthoInspector 1 1.000 T597981
orthoMCL 1 0.900 OOG5_128866
Panther 1 1.100 LDO PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R396
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.