DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and synrg

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:XP_005157496.1 Gene:synrg ZFINID:ZDB-GENE-030131-9396 Length:1409 Species:Danio rerio

Alignment Length:1182 Identity:234/1183 (20%)
Similarity:346/1183 (29%) Gaps:549/1183 (46%)


  Fly   251 FVANFPKDIAPPAAIPPLPVA-VPPMTRIPP--------VGAV---SSQPLIQT----DPLIP-I 298
            |.:.|...:||    .|||.. .||:...||        |||.   ..||::.|    |.||| :
Zfish   341 FHSAFMTGMAP----EPLPATQAPPVADNPPIQPTRASGVGAYPQQDMQPMVPTWLYNDSLIPEL 401

  Fly   299 GAPVMANADWVVTPADLKRFEEIFRQSDLDKDGLVSGLEVKDIFIKSGIPQRSLADIWALCDTNQ 363
            ...|:   ::.:|||.                  :...::..|.|.||:|:.:|..||||.:...
Zfish   402 FKKVL---EFTMTPAG------------------IDTAKLYPILISSGLPREALGQIWALANRTT 445

  Fly   364 SGKLTVEQFALAMWFVERKQRGV------------DPPHVLNANMVP--PSMRATVAGVDLQPQE 414
            .||||.|:....:..:...|.|:            .||       ||  |:|...:..|  .||.
Zfish   446 PGKLTKEELYTVLALIGVAQSGLTVMSLDILSQFPSPP-------VPNLPAMTMAIPAV--LPQH 501

  Fly   415 VKPTYSNPELEM---------ISKEIEELARERRVLETEIAQKEADVRIKNGEVRSLQSELDTLT 470
            .:|..:.|.:.|         :|......|:......|.....:|             ::.|.  
Zfish   502 QQPIMTQPPVSMPMPTAAPPVMSMTPNPPAQPPATFITNFPPVQA-------------TKADD-- 551

  Fly   471 ATLKQLENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQCHMQEVTINEQEGE 535
                             ||.|   ....|..|.|. |.|.|:.|               .|..|.
Zfish   552 -----------------DDFQ---DFQEAPKAGVG-DDSFTDFQ---------------GETGGT 580

  Fly   536 LNAKRSELQKLKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRSMVTQLLETQRQMTDALL 600
            ..:..|..|                                  |||.:|:|.:..:....:|...
Zfish   581 FPSMTSSSQ----------------------------------SSVPAMLTPVSGSSSSSSDKYA 611

  Fly   601 ICRAAMENQNAELVSEYQLKIEPDFDEARKTLTKEVQLPKDDPFEENNSGAANQATNGFGSDPFS 665
            :.:              ||.:|                                           
Zfish   612 VFK--------------QLSVE------------------------------------------- 619

  Fly   666 GQPVN-KPAISTGFDDSFNMSSGFDSGFDAFGQSGAGSAFGQ----TQRDPFGSDAFAANKSNAI 725
             ||.. .||:|             ||| |.:      |.|.:    ::|.|.| :.||..||  :
Zfish   620 -QPAEPTPAVS-------------DSG-DKY------SVFRELEPPSERKPVG-EGFADFKS--V 660

  Fly   726 TPEPGKDDFGSDPFAALHAPTGQGQVLSPNAQKSGPPPRPESPSPALPPKKSK----VPPP---- 782
            :.:.|..||.:                            .::.||..||.::|    .|||    
Zfish   661 SADDGFTDFKT----------------------------ADTVSPLDPPDQAKFQPTFPPPFASS 697

  Fly   783 ----RPAPPRAAQPTGGFGSGGGGGFADFDDF----------DNKLHHIPSAPSPSATALSPLPP 833
                ...|...|||....      ..||.|.|          |:||:..|||           ||
Zfish   698 QSLSHSQPASLAQPRNPL------NMADLDLFTTMAPPTSTADSKLNLFPSA-----------PP 745

  Fly   834 TLPAPIPVVSGSSLLDSFTLFDDPGQIHKQAASTPNPTPITVPTVHTLLQTSLSTPAAPSPALAS 898
            :|..|..||...|:..     ||.|..                   .|..:|.|:..||:.    
Zfish   746 SLVLPSAVVKPPSMGG-----DDFGDF-------------------ALFGSSSSSEVAPTT---- 782

  Fly   899 LSTSGSGSVAGAGADLPSSVTITTAPSLNNQHLSRSNTPLQNQRTADVKLETKAVVSVFDAFGEI 963
                   |.||.||                      :|.:|:. .||           |.|||..
Zfish   783 -------SAAGRGA----------------------STTVQDD-FAD-----------FMAFGSS 806

  Fly   964 GTRKAPTPSL---ITGPTDF----------KDDPFKD------YRYED-------PFSI----KD 998
            ..:::.|.|.   ..|.|:.          |.|.||.      ..|:|       .||.    .|
Zfish   807 RDQRSETSSREGNSEGQTETSQQRHQIGTDKYDVFKQLSLEGGLAYDDNKESGGGSFSSLKSDND 871

  Fly   999 PFAEEGEEELSEGKGADHK---------RNFAEDFSS----------GDEIG------------- 1031
            .||:....:.....||..|         :...||.:|          |..:|             
Zfish   872 DFADFQSSKFCTALGASDKSLVDKVAAFKQAKEDSTSVKSLDLPSIGGSSVGKEDSEDALSVQLD 936

  Fly  1032 ----SAAKTLSNIVNNNSI--------KPKAATPLNNDLLQQFDAFNLNSSPAPSHHSGTSYHSN 1084
                .....|.::::::|:        :|.||.  ::|:  :||.|            |||..| 
Zfish   937 MKLSDMGGDLKHVMSDSSLDLPGLSSHQPPAAE--SDDM--KFDPF------------GTSTVS- 984

  Fly  1085 SKPSHDSQTALDAFADFDDFAA---------------------TLATTGGSGAATTATTTG---- 1124
            |..|:|       ::|.||..:                     ...|:.||....|.||..    
Zfish   985 SLGSYD-------WSDKDDLPSGQGKKLQGGSQGSLPSSAVVQRKETSFGSSENITHTTVAKVTT 1042

  Fly  1125 -----NTKLNNSFFDAFNDNFSVIQSSSVPTGVVRPNDQRAKAFDAFNDNFEDQFKTSPNA---- 1180
                 |:..:.|.|:||.|..|:.|:.       :.:|.   .|..|.....::..:.|:|    
Zfish  1043 FPIEDNSSTSESQFEAFADFGSIEQAG-------QDDDD---DFGDFASTVSEKSDSPPSATEAE 1097

  Fly  1181 --------NFAKFDGFEAHNFSSDFGNASFGTTGKEKQNGQVDKKFQSKEPVKDKFAADYSKPES 1237
                    .|..|.|.:.....|||..||  |..|.|         .|:|.:|::.|       :
Zfish  1098 GNQGEMTDEFGAFQGDKPKFGKSDFLKAS--TQAKVK---------SSEEMIKNELA-------T 1144

  Fly  1238 FDADLEEALKRS 1249
            ||..::.:.|||
Zfish  1145 FDLSVQGSHKRS 1156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009
EH 126..215 CDD:197477
EH 137..202 CDD:238009
EH 307..402 CDD:197477 26/109 (24%)
EH 318..384 CDD:238009 16/66 (24%)
RILP-like <445..548 CDD:304877 16/103 (16%)
Spc24 529..>584 CDD:285486 7/55 (13%)
synrgXP_005157496.1 Med15 <40..>119 CDD:312941
ARGLU <102..135 CDD:330370
Atrophin-1 <173..704 CDD:331285 111/591 (19%)
EH 398..466 CDD:238009 22/89 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0998
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.