DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and EPS15

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:XP_016856104.1 Gene:EPS15 HGNCID:3419 Length:933 Species:Homo sapiens

Alignment Length:1008 Identity:294/1009 (29%)
Similarity:438/1009 (43%) Gaps:233/1009 (23%)


  Fly    15 VYEAYYKLIDPKGTGAIEAMTAAKFLKKSGLSDVVLSRIWDLSDPSGKGFLDKPGFFVALKLVSL 79
            |||.||:.:|...||.:.|..||.|||||||.|::|.:||||:|..|||.|:|..|||||:||:.
Human    18 VYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVAC 82

  Fly    80 SQAGQVASMANIYLDIANPPKLGELPKTMPSRIQTVPVASGGVANGD--WSIGVIDRLKYEQLFE 142
            :|.|...|::::.|.:. ||:..:         .:.|:...|.:..:  |::...|:.||:.:|:
Human    83 AQNGLEVSLSSLNLAVP-PPRFHD---------TSSPLLISGTSAAELPWAVKPEDKAKYDAIFD 137

  Fly   143 SLHPSNGMLPGNKVKGVLMDSKLPMSILGTIWDLADQDKDGNLDMHEFVVAMHLVYQTLQKRTIP 207
            ||.|.||.|.|:|||.||::||||:.|||.:|:|:|.|.||.||..||.|||.|||..|:|..:|
Human   138 SLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVP 202

  Fly   208 SVLPPELRKPGGAGPPPKPAMPPPPAGAAMPRAPSGEGFGDGGFVANFPKDIAPPAAIPPLPVAV 272
            ..|||.|       .||........:|:.                          ..||....|.
Human   203 MSLPPAL-------VPPSKRKTVSISGSV--------------------------RLIPSSASAK 234

  Fly   273 PPMTRIPPVGAVSSQPLIQTDPLIPIGAPVMANADWVVTPADLKRFEEIFRQSDLDKDGLVSGLE 337
            .....:|.||            ::|..||:   ..|||:||:..:::|||.::|.|.||.|||||
Human   235 ESYHSLPSVG------------ILPTKAPL---RQWVVSPAEKAKYDEIFLKTDKDMDGFVSGLE 284

  Fly   338 VKDIFIKSGIPQRSLADIWALCDTNQSGKLTVEQFALAMWFVERKQ-RGVDPPHVLNANMVPPSM 401
            |::||:|:|:|...||.||:||||...|||:.:|||||...:.:|. :|:||||||...|:|||.
Human   285 VREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSD 349

  Fly   402 RATVAGVDLQPQEVKPTYSNPELEMISKEIEELARERRVLETEIAQKEADVRIKNGEVRSLQSEL 466
            ||::....:....|....:..||:.::.||.:|.||:..:|.::.:||..::.:..||:.||.|:
Human   350 RASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEV 414

  Fly   467 DTLTATLKQLENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQCHMQEVTINE 531
            ......|::|:.|:.:.|:.||:|..|.:.....|..|....:...:.::.::.:...||..|:.
Human   415 QRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEAQLISSLKAELTSQESQIST 479

  Fly   532 QEGELNAKRSELQKLKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRSMVTQLLETQRQ-- 594
            .|.||...|.||.:|:.|.|.|::..:|...:|..|..|||.:|.:|||::..:.::.:.:..  
Human   480 YEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEISSMQMKLMEMKDLENHNS 544

  Fly   595 ---------------MTDALLICRAAME--NQNAELVSEYQLKIEP------------------- 623
                           .||...:..::.|  |.|..:..:..|:.||                   
Human   545 QLNWCSSPHSILVNGATDYCSLSTSSSETANLNEHVEGQSNLESEPIHQESPARSSPELLPSGVT 609

  Fly   624 DFDEARKTLTKEV--------QLPKDDPFEENNSG----AANQATNGFGSDPFSGQPVNKPAIST 676
            |.:|....:|::|        ...::|||..::|.    .|:...:.|.||||.|....|     
Human   610 DENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFK----- 669

  Fly   677 GFDDSFNMSSGFDSGFDAFGQSGAGSAFGQTQRDPFGSDAFAANKSNAITPEPGKDDFGSDPFAA 741
              ||.|.....|  |.|.|..|           |||.||.|....::.....      .:|||:|
Human   670 --DDPFGKIDPF--GGDPFKGS-----------DPFASDCFFRQSTDPFATS------STDPFSA 713

  Fly   742 LHAPTGQGQVLSPNAQKSGPPPRPESPSPALPPKKSKVPPPRPAPPRAAQPTGG-FGSGG-GGGF 804
                .....:.|....|...|..|.....|             |...|..|... ||:.. ||||
Human   714 ----ANNSSITSVETLKHNDPFAPGGTVVA-------------ASDSATDPFASVFGNESFGGGF 761

  Fly   805 ADFDDFDNKLHHIP--SAPSPSAT---------------------ALSPL--PPTLPAPIPVVSG 844
            |||.......:..|  ||.|.|.:                     ||.|.  .||.|.|:|    
Human   762 ADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLP---- 822

  Fly   845 SSLLDSFTLFDDPGQIHKQAASTPNPTPITVPTVHTLLQTSLSTPAAPSPALASLSTSGSGSVAG 909
                        ||:.......:|:|             ..|:.|..|.|               
Human   823 ------------PGKRSINKLDSPDP-------------FKLNDPFQPFP--------------- 847

  Fly   910 AGADLPSSV-------TITTAPSLNNQHLSRSN 935
             |.|.|...       ..|:|.:..|:....||
Human   848 -GNDSPKEKDPEIFCDPFTSATTTTNKEADPSN 879

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009 37/66 (56%)
EH 126..215 CDD:197477 47/91 (52%)
EH 137..202 CDD:238009 38/65 (58%)
EH 307..402 CDD:197477 51/96 (53%)
EH 318..384 CDD:238009 35/67 (52%)
RILP-like <445..548 CDD:304877 27/103 (26%)
Spc24 529..>584 CDD:285486 21/55 (38%)
EPS15XP_016856104.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71154447
eggNOG 1 0.900 E1_KOG0998
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 457 1.000 Inparanoid score I1558
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D360276at33208
OrthoFinder 1 1.000 FOG0000866
OrthoInspector 1 1.000 T610277
orthoMCL 1 0.900 OOG5_128866
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R396
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.