DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eps-15 and Ehd3

DIOPT Version :10

Sequence 1:NP_611965.2 Gene:Eps-15 / 37961 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:NP_620245.2 Gene:Ehd3 / 192249 RGDID:621762 Length:535 Species:Rattus norvegicus


Alignment Length:100 Identity:41/100 - (41%)
Similarity:59/100 - (59%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ASGGVANGDWSIGVIDRLKYEQLFESLHPSNGMLPGNKVKGVLMDSKLPMSILGTIWDLADQDKD 182
            |..|:.:.:|.: ..|:..|:::|.:|.|.:|.:.|...|..::.||||.|:||.||.|||.|||
  Rat   430 AGEGIDDAEWVV-ARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADIDKD 493

  Fly   183 GNLDMHEFVVAMHLVYQTLQKRTIPSVLPPELRKP 217
            |.||..||.:|.||:...|:...:||.||..|..|
  Rat   494 GMLDDEEFALANHLIKVKLEGHELPSELPAHLLPP 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009
EH 126..215 CDD:197477 37/88 (42%)
EH 307..402 CDD:197477
SMC_prok_B <423..>632 CDD:274008
Ehd3NP_620245.2 EHD_N <37..56 CDD:465295
EHD 60..300 CDD:206740
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 65..72
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 91..92
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 153..156
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 219..222
DUF5600 288..394 CDD:465667
EH 438..531 CDD:197477 38/91 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.