DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and ehs-1

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:NP_001022499.2 Gene:ehs-1 WormBaseID:WBGene00001224 Length:796 Species:Caenorhabditis elegans

Alignment Length:884 Identity:256/885 (29%)
Similarity:384/885 (43%) Gaps:172/885 (19%)


  Fly     4 DFARVCGKHIGVYEAYYKLIDPKGTGAIEAMTAAKFLKKSGLSDVVLSRIWDLSDPSGKGFLDKP 68
            |...:...|..|:...:..::|.|...|.|..||.|||||.|:..||.:||:|||....|.|||.
 Worm     3 DSYAIATPHNDVFNHAFAEMNPHGAPRIGAAEAATFLKKSNLAMPVLGQIWELSDSQKVGSLDKR 67

  Fly    69 GFFVALKLVSLSQAGQVASMANIYLDIANPPK--------------------LGELPKTMP---- 109
            |.|||.|||:.:|.|:..:.:::|.....||:                    :|..|...|    
 Worm    68 GAFVAFKLVAAAQQGKPVANSSLYDSSLQPPRFAPPVPPANMQHHFQPSFPSVGRAPPVPPPPHP 132

  Fly   110 ------SRIQTVPVASGGVANGDWSIGVIDRLKYEQLFESLHPSNGMLPGNKVKGVLMDSKLPMS 168
                  |..|:.|..........|.|...|:.||:.:|:||:|.||.|.|..|:.|||:|.|...
 Worm   133 SHPYSISSQQSSPAHPSSAFPPQWPITPTDQAKYDSIFQSLNPVNGKLSGAHVRPVLMNSGLDAH 197

  Fly   169 ILGTIWDLADQDKDGNLDMHEFVVAMHLVYQTLQKRTIPSVLPPELRKPGGA----GPPPKPAMP 229
            .|..||:|:|||||||||..|..||:||||::||...:|:.|||.|..|..|    ..|...|.|
 Worm   198 ALARIWELSDQDKDGNLDRIEMSVALHLVYRSLQSDPVPAQLPPNLIHPSKAMYAHSSPNFAAPP 262

  Fly   230 PPPAGAAMPRAPSGEGFGDGGFVANFPKDIAPPAAIPPLPVAVPPMTRIPPVGAVSSQPLIQTDP 294
            .||......||.|.....|.....::...:  |.|.||           .|..|.|:|..:....
 Worm   263 HPPRPMMGSRAGSVTSLDDVNMSQSYSATM--PRAYPP-----------QPGRAYSAQAHVNGSR 314

  Fly   295 LIPIGAPVMAN--------ADWVVTPADLKRFEEIFRQSDLDKDGLVSGLEVKDIFIKSGIPQRS 351
            ......|:.|:        .:|.:...|   :.:.|.|:|.:|||||.|::::...:.:|:..:.
 Worm   315 TSGASTPISASHSIHSFPAGEWPINTGD---YADQFAQTDTNKDGLVDGMDMRAPMMTTGLSAQI 376

  Fly   352 LADIWALCDTNQSGKLTVEQFALAMWFVERKQRGVDPPHVLNANMVPPSMRATVAGVDLQ----- 411
            ||.:|||.|..:.|:|.:|||||.|..::..:||...|..|..:::|||.|.......|.     
 Worm   377 LAHVWALADIKKCGQLNLEQFALTMHLLDMAKRGESIPSELPLHLIPPSFRPPTEPSALHHPAQS 441

  Fly   412 ---PQ-------EVKPTY--SNPELEMISKEIEELARERRVLETEIAQKEADVRIKNGEVRSLQS 464
               ||       |:|...  .|.|::.:::.|:.:..||:..|..:.|.|||:.|||..:::||.
 Worm   442 VSTPQLPEATSMEIKEALEGENEEMKQLAESIQSMLVERKTAEEAVLQLEADMTIKNSSIKNLQV 506

  Fly   465 ELDTLTATLKQLENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQCHMQEVTI 529
            ||.||.:|:||||.|:|||.:||.|...|:.                     ::...|..|:.|.
 Worm   507 ELATLESTVKQLERQKGEATRRLADYDTQIE---------------------QLESACKAQKETK 550

  Fly   530 NEQEGELNAKRSELQKLKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRSMVTQLLETQRQ 594
            .:.|..:.....:.:..:|.:|:.:||.:...:|:..|.|       |..:||..:.:  ||.::
 Worm   551 EDTEKRMQQIDEDAKNAEDCKANDEKEMEELKKEIEMLDN-------QFKTVRGEIVK--ETSQR 606

  Fly   595 MTDALLICRAAMENQNAELVSEYQLKIEPDFDEARKTLTKEVQLPKDDPFEENNSGAANQATNGF 659
                        |.:.|||.:     :|      ||....::|:.|.|...||.:....|.::..
 Worm   607 ------------EQKVAELTT-----LE------RKEARDQIQMEKLDAAIENTTKLTEQVSDAV 648

  Fly   660 GSDPFSGQPV---NKPAISTGFDDSFNMSSGFDSGFDAFGQSGAGSAFGQTQRDPFGSDAFAANK 721
            .........:   .:..:||..|.|..      |....:|::...|:....|:.|   |.||:.:
 Worm   649 EKSEEEMVQILRSQQRLLSTVIDQSLL------SDDTVYGETAGTSSQNHVQQPP---DPFASAR 704

  Fly   722 SN-AITPEPGKDDFGS----------DPFAALHAPTGQGQVLSPNAQKSGPPPRPESPSPALPPK 775
            :| |..|....|.|||          ||||       ||...|.:......|.:|..|.|| |||
 Worm   705 ANPAADPFAQVDQFGSSGHFDAAFPTDPFA-------QGGFPSDSGFAQSAPAKPAPPRPA-PPK 761

  Fly   776 KSKVPPPR----PAPPRAAQPTGGFGSGGGGGFADFDDF 810
            .::..|..    |:..::.||         .|||||.||
 Worm   762 SARETPVNDPFAPSQGQSTQP---------AGFADFADF 791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009 31/66 (47%)
EH 126..215 CDD:197477 46/89 (52%)
EH 137..202 CDD:238009 36/65 (55%)
EH 307..402 CDD:197477 33/95 (35%)
EH 318..384 CDD:238009 24/66 (36%)
RILP-like <445..548 CDD:304877 30/103 (29%)
Spc24 529..>584 CDD:285486 11/55 (20%)
ehs-1NP_001022499.2 EH 15..81 CDD:238009 31/66 (47%)
EH 155..249 CDD:197477 47/94 (50%)
EH 166..231 CDD:238009 36/65 (55%)
EH 335..427 CDD:197477 33/95 (35%)
EH 343..409 CDD:238009 24/66 (36%)
TMF_TATA_bd 446..539 CDD:289123 35/114 (31%)
RILP-like 457..>548 CDD:304877 34/112 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131068478
eggNOG 1 0.900 E1_KOG0998
Hieranoid 1 1.000
Homologene 1 1.000 H31881
Inparanoid 1 1.050 298 1.000 Inparanoid score I1625
Isobase 1 0.950 0.721928 Normalized mean entropy S4078
OMA 1 1.010
OrthoDB 1 1.010 D360276at33208
OrthoFinder 1 1.000 FOG0000866
OrthoInspector 1 1.000 T474158
orthoMCL 1 0.900 OOG5_128866
Panther 1 1.100 LDO PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R396
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.