DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and si:ch73-140j24.4

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:XP_005171174.1 Gene:si:ch73-140j24.4 ZFINID:ZDB-GENE-131120-193 Length:1075 Species:Danio rerio

Alignment Length:1160 Identity:225/1161 (19%)
Similarity:376/1161 (32%) Gaps:356/1161 (31%)


  Fly   323 RQSDL--DKDGLVSGLEVKDIFIKSGIPQRSLADIWALCDTNQSGKLTVEQFALAMWFVERKQRG 385
            |.::|  ..:|....:|:|.:..:..|.:.:|....|||.:.|.   |||:..      |||   
Zfish    23 RDAELQAQDNGTSEDIEIKGLKDEVHIEEETLQTTKALCRSTQE---TVEKLE------ERK--- 75

  Fly   386 VDPPHVLNANMVPPSMRATVAGVDLQPQEVKPTYSNPELEMISKEIEELARERRVLETEIAQKEA 450
                                            |....|||:| .::::  :||.||         
Zfish    76 --------------------------------TLLREELEII-HDLQK--QEREVL--------- 96

  Fly   451 DVRIKNGEVRSLQSELDTLTATLKQLENQRGEAQKRLDDLQAQVSH----------NTAVLANVS 505
                     ||||.:...|..||:|.:.....|.:.|..||..|::          ..|.|.:|.
Zfish    97 ---------RSLQEQQQELEQTLQQYDTDLCAAAEDLLQLQRDVAYAKTHAESLHVRIAPLQDVF 152

  Fly   506 LDISRTNEQVTK-----IRDQCHMQEVT---INEQEGELNAKRSELQKLKDEEASLQKE------ 556
            .:|.:..:::::     |..:|...|:|   ..:.:||::...||..::..|....::|      
Zfish   153 QEIVQVKKKLSELVAGLITGECAASEITDDHCEDLDGEMDVVESECDQVYSENILSEQEGEEMDH 217

  Fly   557 --YDSNNRELSKLTNHLQATQLQISSVRSMVTQLLETQRQMTDALLICRAA--------MENQNA 611
              .:|...||.|:...|:..:   ||..|..|::..|:.:..|.:.  |:.        ||.::.
Zfish   218 IGQESTVEELDKMQRSLENLK---SSGSSSFTEITLTEVKEEDVMF--RSTTPQSDSSDMEKEDF 277

  Fly   612 ELVSEYQLKIEP-DF--------------DEARKTLTKEVQLPKDDPFEENNSGAANQATNGFGS 661
            |::...|...:. ||              |...|....| |||: |||:              |:
Zfish   278 EIIQPSQATNKQFDFFHPNPFTDGDVFGDDHFPKVDVTE-QLPR-DPFK--------------GT 326

  Fly   662 DPFSGQ------------PVNKPAISTGFDDSFN---MSSGFDSG-FDAFGQSGAGSAFGQ-TQR 709
            |||:..            |........||.|:.:   .|:|.|.| |:|......|:.|.| |:.
Zfish   327 DPFASDSLLVATSDEEHCPDGFTTEDNGFPDTLHYPFQSAGKDYGTFNAPINMPLGADFKQSTEN 391

  Fly   710 DPFGSDAFAANKS--------NA-------------ITPEPGK-------------DDFGSDPFA 740
            ..|.|....:.||        ||             ::||..:             |.|.:||..
Zfish   392 IDFQSTESKSLKSCPDFEVETNATRKQTQEYVQPEDVSPEISEEFVHESGSSSTISDSFEADPIT 456

  Fly   741 -----ALHAPTGQGQVLSPNA----------QKSGPPPRPESPSPA------------------- 771
                 .:....|:..:..||:          ..:|.|..|..|.|.                   
Zfish   457 LAEVDRVETKAGRSFIKGPNSLCGLQSIIAGSYTGFPLSPCDPEPVSGISDIQKIFEHHIITSEQ 521

  Fly   772 ------------LPPKKSKVPPP---RPAPPRAAQPTGGFGSGGGGGFAD-FDDFDNK------- 813
                        |..|.::...|   ...|...::......|.......: .|.:|.|       
Zfish   522 HAEHDKDGSHTELENKNTESVSPDLENTTPGLQSEQLHDINSNASESQPNALDVYDYKYGDMFFF 586

  Fly   814 ----------LH-HIPSAPSPSATALSPLPPTLP----APIPVVSGSSLLDSFTLFDDPGQIHKQ 863
                      || |.|..|.|:..........||    ...|..||...||..:...:..:.|.|
Zfish   587 TVRLDPGSPELHSHGPVCPEPNDVKKDESNDQLPWKDTTLSPEFSGVDELDCCSPKSEDTEEHNQ 651

  Fly   864 AAS---------TPNPTPITVPTVHTLLQTSLSTPAAPSPALASLSTSGSGSVAGA---GADLPS 916
            ..:         .|:......|..:.:|::.......|.|......:....||..:   ..|.|:
Zfish   652 NTNGGQNYFDDRDPDNDANIDPIGNEVLESDCERSEIPIPRFTFDDSDACQSVHNSEWDDEDYPN 716

  Fly   917 S--VTITTAPSLNNQHL----SRSNTPLQNQRTADVKL----------ETKAV----VSVFDAFG 961
            :  .:|...|....|.|    |.::|...:|..||.:|          |..|:    :..||.|.
Zfish   717 APEPSIEDTPKSTVQDLLCMFSNTDTSTTDQVCADEQLLTEFSSQKPSENSAMSQYELQYFDPFS 781

  Fly   962 --------------EIGTRKAPTPSLITG------PTDFKDDPFKDYRYEDPFSIKDPFAEEGEE 1006
                          |:.:.....|.|.:|      ||.|..:|  ..:.:....::||       
Zfish   782 PIPAEPVECASDLHEMNSFSHEAPRLDSGYHEVGTPTYFSAEP--TGKIKCSIDLQDP------- 837

  Fly  1007 ELSEGKGADHKRNFAEDFS-SGDEIGSAAKTLSNIVNNNSI------KPKAATPLNNDLLQQFDA 1064
            .|:.||.:|.:.:.|:.|| ...:.|.......|..::..|      .|...|.|||...:|. :
Zfish   838 GLATGKQSDSEIHVADPFSPESVDTGIFDSETENCESSYMITKCQLFSPLVYTDLNNVEEKQM-S 901

  Fly  1065 FNLNSS--PAPSHHSGTS----YHSNSKPSHDSQTALDA------FADFDDFAATLATTGGSGAA 1117
            ||.|.|  ....|.||:.    :...|.||::...|..:      .:|.:....::.....:.|.
Zfish   902 FNNNVSCDILSDHLSGSEPDDCFPFGSCPSNEESYAYSSEGLTQDGSDGEFKHGSMMANASNSAE 966

  Fly  1118 TTATTTGNTKLNNSFFDAFND-NFSVIQSSSVPTGVVRPNDQRAKAFDAFNDNFEDQFKTSPNAN 1181
            ...:...|::::.|..|.|:. ..::....|...|...|:         .|.:.||..|.|..|:
Zfish   967 LMDSVWRNSEMSLSNADMFDPMKNTIFDFDSTDVGSFMPD---------VNQHAEDGEKVSKKAD 1022

  Fly  1182 FAKFDGFEAHNFSSDFGNASFGTTGKEKQNGQVDKKFQSKEPVKDKFAADYSKPE 1236
            ..:.|     .|.|:.......::....|....:..|.|:......:..|:.|.:
Zfish  1023 LVEID-----YFCSELSKMVSSSSSDSVQQSVAEMLFGSEPNTSSFYPWDFEKQQ 1072

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009
EH 126..215 CDD:197477
EH 137..202 CDD:238009
EH 307..402 CDD:197477 17/81 (21%)
EH 318..384 CDD:238009 17/63 (27%)
RILP-like <445..548 CDD:304877 25/121 (21%)
Spc24 529..>584 CDD:285486 14/63 (22%)
si:ch73-140j24.4XP_005171174.1 SMC_prok_B <28..>256 CDD:274008 61/296 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0998
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.