DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps-15 and eps15l1b

Sequence 1:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:XP_021323982.1 Gene:eps15l1b ZFINID:ZDB-GENE-140213-1 Length:881 Species:Danio rerio

Alignment Length:900 Identity:296/900 (33%)
Similarity:441/900 (49%) Gaps:166/900 (18%)


  Fly    16 YEAYYKLIDPKGTGAIEAMTAAKFLKKSGLSDVVLSRIWDLSDPSGKGFLDKPGFFVALKLVSLS 80
            ||:.|:.:||..||.:.|..||:|||||||||..|.:|||||||..||:|||.|||.||:||:.:
Zfish    17 YESLYRQVDPANTGRVGAAEAAQFLKKSGLSDSTLGQIWDLSDPDRKGYLDKKGFFTALRLVASA 81

  Fly    81 QAGQVASMANIYLDIANPPKLGELPKTMPSRIQTVPVASGGVANGDWSIGVIDRLKYEQLFESLH 145
            |.|...|:.::..:|:.|     :||...:...::.: :|..|:..|::...|:.||:.:||||.
Zfish    82 QGGSDVSLNSLSQNISAP-----MPKFRDAGSPSLNI-TGSSADSSWTVKPEDKAKYDGIFESLS 140

  Fly   146 PSNGMLPGNKVKGVLMDSKLPMSILGTIWDLADQDKDGNLDMHEFVVAMHLVYQTLQKRTIPSVL 210
            |..|:|.|:|||.|||:|.||:.:||.||||:|.||||:||..||.|||||||...:|..:||.|
Zfish   141 PIGGLLSGDKVKLVLMNSNLPLDVLGKIWDLSDIDKDGSLDKDEFSVAMHLVYAAREKEPVPSSL 205

  Fly   211 PPEL------RKPGGAGPPPKPAMPPPPAGAAMPRAPSGEGFGDGGFVANFPKDIAPPAAIPPLP 269
            |..|      :|..||.|...|.:|..|                  |:  ..:::.|..|:...|
Zfish   206 PTSLIPPSKRKKIAGALPGSVPVLPSSP------------------FL--LKENLRPTPALSKSP 250

  Fly   270 VAVPPMTRIPPVGAVS----SQPLIQTDPLIPIGAPVMANAD-WVVTPADLKRFEEIFRQSDLDK 329
            :.  ..|.:.|..:.:    :.|..||          .|::| |||...|.:::||||..:|.|.
Zfish   251 LG--SSTNLSPSNSFNRSTPTPPQTQT----------QASSDHWVVPADDREQYEEIFELADSDF 303

  Fly   330 DGLVSGLEVKDIFIKSGIPQRSLADIWALCDTNQSGKLTVEQFALAMWFVERKQRGVDPPHVLNA 394
            ||:|.|.||||||:.|.:||..||.||:|.||..:||||.|||.|||..::.:.:||:||..|..
Zfish   304 DGMVGGGEVKDIFMNSRLPQSVLAHIWSLADTKGTGKLTKEQFCLAMHLIQERVKGVEPPKSLTP 368

  Fly   395 NMVPPSMRATV-----------AGVDLQPQEVKPTYSN---------------PELEMISKEIEE 433
            .|:|||.|...           .|.:|.|......:|.               .:|:.||:||.:
Zfish   369 EMIPPSERGAANTPILSAYTPSVGSELTPLTPLTNFSRDSSSSSVGKVELLGIKDLDDISQEISQ 433

  Fly   434 LARERRVLETEIAQKEADVRIKNGEVRSLQSELDTLTATLKQLENQRGEAQKRLDDLQAQVSHNT 498
            |..|:|||||||.|||..:|.:|.|::..|..|:.....|::||:|:.:||.||::::.|     
Zfish   434 LQSEKRVLETEIRQKEEVLRQRNSEIQEEQRGLERENVDLQELEHQKRDAQDRLNEMEMQ----- 493

  Fly   499 AVLANVSLDISRT-----NEQVTKIRDQCHMQEVTINEQEGELNAKRSELQKLKDEEASLQKEYD 558
            .|....|||.:::     |.:::.::.|...||..:..||.|::..:::|..|:.||..|:....
Zfish   494 RVKLQSSLDETKSKWQEENAKISSLQTQIMSQESNVQTQEKEMSRTKTDLYCLEQEEERLEDSLR 558

  Fly   559 SNNRELSKLTNHLQATQLQISSVRSMVTQLLETQRQMTDAL-LICRAAMENQN----AELVSEYQ 618
            :...:|..:...|:.:|.::...||.::.:.|:||::..:: ...:|..||.:    .::::|.:
Zfish   559 AGKAKLDSILKLLKTSQDEMDQTRSELSLIQESQRELNKSIERYSKALTENMSLTDLEQIIAEEE 623

  Fly   619 LKIEPDFDEARKTLTKEVQLPKDDPFEENNSGAANQATNGFGSDPFSGQPVNKPAISTGFDDSFN 683
            .........:..|..:|..|.|......|:.|     :...|||||..            :|.|.
Zfish   624 NNSSSSSSISSSTEAREDSLVKSRMAMFNSGG-----SKALGSDPFQS------------EDPFK 671

  Fly   684 MSSGFDSGFDAFGQSGAGSAFGQTQRDPFGSDAFAANKSNAITPEPGKDDF-GSDPFAALHAPTG 747
            .        |.|.::           ||||.|.|..|       :|.||.| .||||       |
Zfish   672 S--------DLFSKA-----------DPFGGDPFKQN-------DPFKDPFANSDPF-------G 703

  Fly   748 QGQVLSPNAQKSGPPPRPESPSPALPPKKSKVPPPRPAPPRAA-QPTGGFGSGGGGGFADFDDFD 811
            :.   |.:..|:.|..|..|       :.|..|.|:.:.|.|| .|..|...||.||||||....
Zfish   704 ES---SSSQLKASPFTRRIS-------QTSMSPKPKDSDPFAASDPFSGDAFGGKGGFADFSQMS 758

  Fly   812 NKLHHIPSAPSPSATALSPLP------PTLPAPIPVVSG--SSLLDSFTLFDDPG 858
            .....|...|:      .|||      |..|||.|.|||  :|:.:|.::..:.|
Zfish   759 KSSESINRRPT------YPLPPPKKPGPQRPAPPPYVSGKNTSVTNSGSVVHNQG 807

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009 40/66 (61%)
EH 126..215 CDD:197477 49/95 (52%)
EH 137..202 CDD:238009 40/65 (62%)
EH 307..402 CDD:197477 50/96 (52%)
EH 318..384 CDD:238009 36/66 (55%)
RILP-like <445..548 CDD:304877 31/108 (29%)
Spc24 529..>584 CDD:285486 13/55 (24%)
eps15l1bXP_021323982.1 EH 17..82 CDD:238009 39/65 (60%)
EH 122..215 CDD:197477 49/93 (53%)
EH 282..376 CDD:197477 49/94 (52%)
SMC_N 419..>643 CDD:330553 61/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D360276at33208
OrthoFinder 1 1.000 FOG0000866
OrthoInspector 1 1.000 T597981
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.