DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE12 and TEF4

Sequence 1:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae

Alignment Length:244 Identity:49/245 (20%)
Similarity:95/245 (39%) Gaps:60/245 (24%)


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEA-T 64
            ||:..| |...||.:.|.........||:::  ::|    ..:.||..|.|....|..:..:. .
Yeast     1 MSQGTL-YINRSPRNYASEALISYFKLDVKI--VDL----EQSSEFASLFPLKQAPAFLGPKGLK 58

  Fly    65 IIDSHAICAYLVEKYGQKEQ--QLYPKELVQR---------ANVDARLHLDSGHLFARLRFLYEP 118
            :.::.||..||..:...:::  :|...:::::         ||.|...::      ||....::.
Yeast    59 LTEALAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSNI------ARPFLSFKG 117

  Fly   119 ILYYGSTD---C--SIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCA-------VATVTSV 171
            ::.|...|   |  .||.:|      .:.:..|:|..::...::::.|..|       :||:   
Yeast   118 LIPYNKKDVDACFVKIDNLA------AVFDARLRDYTFVATENISLGDLHAAGSWAFGLATI--- 173

  Fly   172 NDTAPIDEFKFPKMHAWLKRLAELPYYQEVNGDGADELKSIF-KAKLAE 219
              ..|....|.|.:..|...:|..|.           :|:.| :.||||
Yeast   174 --LGPEWRAKHPHLMRWFNTVAASPI-----------VKTPFAEVKLAE 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 17/74 (23%)
GstA 6..201 CDD:223698 41/219 (19%)
GST_C_Delta_Epsilon 92..210 CDD:198287 23/139 (17%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 17/75 (23%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 29/150 (19%)
EF1G 253..356 CDD:306993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91917750
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.