DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE12 and GTT2

Sequence 1:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae

Alignment Length:250 Identity:61/250 (24%)
Similarity:98/250 (39%) Gaps:60/250 (24%)


  Fly     1 MSKPALYYATLSPPSRA---VLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGE 62
            |.:..:.|.|.:.|..|   :.|..|.:...::...|||.||||..||||..|...|:|.|...:
Yeast    15 MKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDD 79

  Fly    63 ATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSG--HLF---ARLRFLYEPI--- 119
            .|:|   |.|..:.|         |...|.....:..:..|:.|  |:.   |.|..| :|:   
Yeast    80 GTLI---AECTAITE---------YIDALDGTPTLTGKTPLEKGVIHMMNKRAELELL-DPVSVY 131

  Fly   120 LYYGSTDCSIDKIAYIQKCW------EILEGF------LKDQPYLCGSDLTIADFCAVATVTSVN 172
            .::.:.....:...|..|.|      :.|.|.      |:::||:.|...::||...:|.:.   
Yeast   132 FHHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLI--- 193

  Fly   173 DTAPIDEFKFPK----MHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAENRGK 223
             .|.|.:.:.|:    :.||.||:.:.|..:                ||.|.|.|
Yeast   194 -FAAIVKLQVPEECEALRAWYKRMQQRPSVK----------------KLLEIRSK 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/76 (33%)
GstA 6..201 CDD:223698 55/222 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/142 (19%)
GTT2NP_013040.1 GstA 19..225 CDD:223698 56/239 (23%)
GST_N_GTT2_like 19..94 CDD:239349 27/87 (31%)
GST_C_GTT2_like 106..222 CDD:198291 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1682
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.