DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE12 and GSTF12

Sequence 1:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana

Alignment Length:210 Identity:48/211 (23%)
Similarity:87/211 (41%) Gaps:29/211 (14%)


  Fly    10 TLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAY 74
            |.:.|.| |||.....|::.|:..|:|...|...||.|...|...:|.:.||:..:.:|.||..|
plant    10 TAACPQR-VLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARY 73

  Fly    75 LVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQKC- 138
            ...|:..:...|..|.|..||.||....:::.:    ...|.:|::..     .|.|....:|| 
plant    74 YATKFADQGTNLLGKSLEHRAIVDQWADVETYY----FNVLAQPLVIN-----LIIKPRLGEKCD 129

  Fly   139 --------------WEILEGFLKDQPYLCGSDLTIADFC---AVATVTSVNDTAPIDEFKFPKMH 186
                          .:|....|....:|.|.:.|:||..   |:..:.|:.|...:.:.: ...:
plant   130 VVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMVKAR-GSFN 193

  Fly   187 AWLKRLAELPYYQEV 201
            .|.:.:::.|.::::
plant   194 RWWEEISDRPSWKKL 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/67 (33%)
GstA 6..201 CDD:223698 48/209 (23%)
GST_C_Delta_Epsilon 92..210 CDD:198287 22/129 (17%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 48/211 (23%)
GST_N_Phi 2..77 CDD:239351 22/68 (32%)
GST_C_Phi 91..209 CDD:198296 22/129 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.