DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE12 and gstt1

Sequence 1:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_002931957.2 Gene:gstt1 ID: Length:244 Species:Xenopus tropicalis

Alignment Length:216 Identity:65/217 (30%)
Similarity:101/217 (47%) Gaps:39/217 (18%)


  Fly     2 SKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATII 66
            |:..||...||.|.|:|.:.|||..:......:.||||||||.||.|::..|.:|.|.||..|:.
 Frog     4 SELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKGEHLTQEFGKVSVLHKVPALKDGNFTMA 68

  Fly    67 DSHAICAYLVEKYGQKEQQLYPKELVQRANVDARL---HLDSGHLFARLRFLYEPILYYGS---- 124
            :|.|:..||..|| :.....||.:|.:||.||..|   |.::           .|   :||    
 Frog    69 ESTAMLLYLARKY-KTPNHWYPSDLQKRARVDEYLAWQHTNT-----------RP---HGSKVFW 118

  Fly   125 TDCSIDKI---------------AYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDT 174
            |.|....|               .::.......|.||.::|::.|.::::||..|:..:..| ..
 Frog   119 TKCVSPTILGKEVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQV-IA 182

  Fly   175 APIDEF-KFPKMHAWLKRLAE 194
            :.::.| :.||:.:|.:||.|
 Frog   183 SGVNVFEERPKLGSWKQRLVE 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 31/73 (42%)
GstA 6..201 CDD:223698 64/213 (30%)
GST_C_Delta_Epsilon 92..210 CDD:198287 28/127 (22%)
gstt1XP_002931957.2 GstA 6..204 CDD:223698 64/215 (30%)
GST_N_Theta 6..81 CDD:239348 32/75 (43%)
GST_C_Theta 94..220 CDD:198292 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.