DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE12 and GstD8

Sequence 1:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster

Alignment Length:218 Identity:82/219 (37%)
Similarity:123/219 (56%) Gaps:10/219 (5%)


  Fly     7 YYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAI 71
            ||...|.|.|:|::||||:|:||.::.:.::.||.|.|||:||||||.||||:|...:|.:|.||
  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAI 68

  Fly    72 CAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLF-ARLRFLYEPILYYGSTDCSIDKIAYI 135
            ..||||||| .:..|||.:..::|.|:.||:.|.|.|| :.:..:|..|......|  .:.:..:
  Fly    69 LIYLVEKYG-ADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPAD--PEAMQKV 130

  Fly   136 QKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPYYQE 200
            ...:..|:.||:||.|:.|..|||||...:|:| |..:....|..::|.:..|.:...|:....|
  Fly   131 DSAFGHLDTFLEDQEYVAGDCLTIADIALLASV-STFEVVDFDIAQYPNVARWYENAKEVTPGWE 194

  Fly   201 VNGDGADELKSIFKAKLAENRGK 223
            .|.||...:|     ||.:.|.:
  Fly   195 ENWDGVQLIK-----KLVQERNE 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 37/70 (53%)
GstA 6..201 CDD:223698 75/195 (38%)
GST_C_Delta_Epsilon 92..210 CDD:198287 34/119 (29%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 73/188 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 37/70 (53%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/119 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92092048
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.