DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE12 and eEF1gamma

Sequence 1:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster

Alignment Length:214 Identity:48/215 (22%)
Similarity:83/215 (39%) Gaps:22/215 (10%)


  Fly     1 MSKPALYYATLSPPSRA--VLLTAKAIGLDLELRPINLLKGE-HLTPEFLKLNPQHTIPTLIDGE 62
            |.|..||  |.....||  .|:.|:..|..:::.. |...|| :.:.||||..|...:|.....|
  Fly     1 MVKGTLY--TYPENFRAYKALIAAQYSGAQVKVAD-NFKFGETNKSAEFLKKFPGGKVPAFETAE 62

  Fly    63 ATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHL-DSGHLFARLRFLYEPIL----YY 122
            ...:......|||:    ..||....|....:|.|...:.. |:..:.|...::: |:|    ..
  Fly    63 GQYLSESNAIAYLL----ANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVF-PLLGILPQQ 122

  Fly   123 GSTDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVND--TAPIDEFKFPKM 185
            .::....:..|.:|:    |...|:|..:|.|..:|:||....:::..:.:  ..|.....|..:
  Fly   123 KNSTAKQEAEAVLQQ----LNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNV 183

  Fly   186 HAWLKRLAELPYYQEVNGD 204
            :.|...:......|.|..|
  Fly   184 NRWFVTILNQKQVQAVVKD 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/76 (28%)
GstA 6..201 CDD:223698 44/205 (21%)
GST_C_Delta_Epsilon 92..210 CDD:198287 22/121 (18%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 21/82 (26%)
GstA 5..187 CDD:223698 43/194 (22%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 22/119 (18%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91162741
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.