DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE12 and gfzf

Sequence 1:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster

Alignment Length:211 Identity:64/212 (30%)
Similarity:105/212 (50%) Gaps:10/212 (5%)


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||..:..|||.||.:|.||:.:..:|..::....||.:.|:.|:|||..||.|.|....:.:|.|
  Fly   814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIA 878

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARL-RFLYEPILY-YGSTDCSIDKIA 133
            |..||.:||. .:..|||:::..||.::.||..:.|..:|.: .....||.: |..|..|:.|  
  Fly   879 IMQYLCDKYA-PDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKK-- 940

  Fly   134 YIQKCWEILEGFLK--DQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRL-AEL 195
             :|...::.|.:|:  ...|..|.::||||| |:.:.|...:....|..:|..::.|.:.. .|.
  Fly   941 -VQNALDVFETYLQRLGTKYAAGENITIADF-ALISATICLEAINFDLHQFTLVNKWYETFKVEY 1003

  Fly   196 PYYQEVNGDGADELKS 211
            |...|:...|..|:.:
  Fly  1004 PQLWEIANSGMQEISA 1019

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/71 (38%)
GstA 6..201 CDD:223698 62/200 (31%)
GST_C_Delta_Epsilon 92..210 CDD:198287 32/123 (26%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 27/72 (38%)
GstA 812..1000 CDD:223698 59/191 (31%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 32/121 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.