DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE12 and eef1g

Sequence 1:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_012809037.1 Gene:eef1g XenbaseID:XB-GENE-975013 Length:438 Species:Xenopus tropicalis

Alignment Length:191 Identity:39/192 (20%)
Similarity:75/192 (39%) Gaps:19/192 (10%)


  Fly    43 TPEFLKLNPQHTIPTLIDGEA-TIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSG 106
            |.||||..|...:|.....:. .:.:|.||..|:.....:...:|:..:::|      .|.....
 Frog    46 TSEFLKKFPLGKVPAFEGNDGFCLFESSAIAHYVGNDELRGTNRLHQAQVIQ------WLSFSDS 104

  Fly   107 HLFARLRFLYEP---ILYYG--STDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVA 166
            |:.........|   |:.|.  :|:.:.::|..:   ..:|:..||.:.:|.|..:|:||.....
 Frog   105 HIVPPASAWVFPTLGIMQYNKQATEQAKEEIKAV---LGVLDSHLKTRTFLVGERVTLADIAVTC 166

  Fly   167 TVTSVNDTAPIDEFK--FPKMHAWLKRLAELPYYQEVNGDG--ADELKSIFKAKLAENRGK 223
            ::..:........|:  |..:..|.......|.::.|.|:.  .|::......|.||.:.|
 Frog   167 SLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQPK 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 11/35 (31%)
GstA 6..201 CDD:223698 32/166 (19%)
GST_C_Delta_Epsilon 92..210 CDD:198287 23/127 (18%)
eef1gXP_012809037.1 GST_N_EF1Bgamma 4..82 CDD:239342 11/36 (31%)
GstA 5..203 CDD:223698 32/166 (19%)
GST_C_EF1Bgamma_like 92..213 CDD:198290 23/130 (18%)
EF1G 276..382 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.