DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and neur

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_476652.1 Gene:neur / 41085 FlyBaseID:FBgn0002932 Length:754 Species:Drosophila melanogaster


Alignment Length:218 Identity:57/218 - (26%)
Similarity:86/218 - (39%) Gaps:68/218 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RFHPYHGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLTELA 128
            :||..||.||::..|.|:|.|..||..|:|||.||:...:...|:..:|...|:|.:|.|.|...
  Fly   108 QFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSND 172

  Fly   129 PNVIRTSSEG-LPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDATHV 192
            |    .:.|| ||.:|.|||.|....|    :|....|..:.::|:....:.|      ||    
  Fly   173 P----VTLEGTLPKYACPDLTNRPGFW----AKALHEQYCEKDNILYYYVNGA------GD---- 219

  Fly   193 RTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPVSRDI 257
                                              :||  .:.::.||   .|:.|:|        
  Fly   220 ----------------------------------VIY--GINNEEKG---VILTGID-------- 237

  Fly   258 PLNRAPLFVVIDVYGTTKQIRII 280
              .|:.|:.|||:||....|..:
  Fly   238 --TRSLLWTVIDIYGNCTGIEFL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 57/216 (26%)
SOCS_SOCS_like 283..321 CDD:239687
neurNP_476652.1 NEUZ 106..225 CDD:128856 44/170 (26%)
SPRY 108..255 CDD:295394 56/213 (26%)
Neuralized 109..173 CDD:284568 25/63 (40%)
NEUZ 367..489 CDD:128856
SPRY 371..519 CDD:295394
Neuralized 371..436 CDD:284568
zf-C3HC4_3 700..748 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12429
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.