DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and neurl1b

DIOPT Version :8

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002941593.1 Gene:neurl1b / 100496809 XenbaseID:XB-GENE-6469687 Length:553 Species:Xenopus tropicalis

Alignment Length:257 Identity:60/258 (23%)
Similarity:94/258 (36%) Gaps:77/258 (30%)


  Fly    32 PDPDQEQDRGRESPIGS-LECAPTLSSRKRQLS-----RFH-PYHGSNIQLGDDATVAYRRASFA 89
            ||.......|...|..: |.|.   ..|:..||     ||| ...|.||:|......|.||.||.
 Frog    10 PDTSHHSRTGANRPCYTFLHCG---QERRLVLSRTESPRFHCQAKGKNIRLDTYGRKAIRRNSFC 71

  Fly    90 DALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLTELAPNVIRTSSEGLPHFALPDLANLGNSW 154
            :.:||:.||:...:...:::..:..||||.:|.|.|...|..::.  |.:|.:|.|||......|
 Frog    72 NGITFTSRPIHLYEKVRLKLVSVHHGWSGALRFGFTIHDPAQMKL--EDIPKYACPDLVTRPGYW 134

  Fly   155 IYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDATHVRTPRGLLPKRLLRPAMGNGNDSDILLT 219
                                                     ...||:|..:        .|.:|.
 Frog   135 -----------------------------------------AKALPERFAQ--------RDNILA 150

  Fly   220 DKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPVSRDIPLN-RAPLFVVIDVYGTTKQIRII 280
                    .:|     |..|.:.:.:|  |..||.....:. .:||:.:|||||.|::::::
 Frog   151 --------FWV-----DRHGRVFYSVN--DEEPVLFHCGVKVSSPLWALIDVYGITQEVQLL 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 51/218 (23%)
SOCS_SOCS_like 283..321 CDD:239687
neurl1bXP_002941593.1 SPRY 45..194 CDD:295394 51/215 (24%)
NEUZ 45..164 CDD:128856 39/183 (21%)
Neuralized 46..111 CDD:284568 22/65 (34%)
NEUZ 281..400 CDD:128856
SPRY 282..431 CDD:295394
Neuralized 283..348 CDD:284568
zf-C3HC4_3 497..547 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.