DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and neurl2

DIOPT Version :8

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002932555.2 Gene:neurl2 / 100494896 XenbaseID:XB-GENE-1010743 Length:274 Species:Xenopus tropicalis

Alignment Length:284 Identity:106/285 (37%)
Similarity:152/285 (53%) Gaps:38/285 (13%)


  Fly    48 SLECAPTLSSRKRQLSRFHPYHGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKI 112
            :::|.|.:|        ||..||:|:::....|:|.|..|||:.:.||:.||.||.|||||||..
 Frog    11 AVQCQPFMS--------FHHIHGANVRIDPSGTLATRVESFANGICFSQEPLQPGQIFLVEIEDK 67

  Fly   113 ERGWSGHMRLGLTELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISK--FEMNQRQDANDIIEP 175
            |.||.||:|:||....|:    :.:.:|.::||||.|.|.|||:.|::  .::...:|:|.|   
 Frog    68 ELGWCGHLRVGLMARDPH----NLDVVPEYSLPDLVNEGGSWIFAITRNHNKVQTEEDSNTI--- 125

  Fly   176 ETDDAPHRNLLGDATHVRTPRGLLPKRLLRPAMGNGNDSDIL----------LTDKGSRIGIIYV 230
                 ..:.||.| .:::..:...|:..|......|..|.||          .|...||||::|.
 Frog   126 -----AIKGLLAD-PYLKVGKFKYPREKLVARSRPGRFSHILDELYKSNVLPPTALRSRIGVLYE 184

  Fly   231 PTVQSDSKGELHFIINGVDRGPVSRDIPLNRAPLFVVIDVYGTTKQIRIIQLE-GILSLQSACRN 294
            |  |||....:|.||||.|.||.::.||... ||:.||||:.:||.:|:|||| |..|||:.||.
 Frog   185 P--QSDGTRNMHIIINGEDMGPSAKGIPATE-PLYAVIDVFASTKSVRVIQLEYGFPSLQTLCRL 246

  Fly   295 VILESFAED-AISELPLPESIKRF 317
            ||.:..... |...|.||..:|.|
 Frog   247 VIQKHIVHRLAFDWLDLPTMLKNF 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 85/228 (37%)
SOCS_SOCS_like 283..321 CDD:239687 15/38 (39%)
neurl2XP_002932555.2 SPRY_NHR_like 19..231 CDD:293945 86/236 (36%)
SOCS_box 238..274 CDD:198037 13/34 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4625
Hieranoid 1 1.000
Homologene 1 1.000 H15435
Inparanoid 1 1.050 156 1.000 Inparanoid score I4082
OMA 1 1.010
OrthoDB 1 1.010 D1185754at2759
OrthoFinder 1 1.000 FOG0007383
OrthoInspector 1 1.000 T1061351
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5784
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.