DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and neurl4

DIOPT Version :8

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001090721.1 Gene:neurl4 / 100036703 XenbaseID:XB-GENE-5825550 Length:1477 Species:Xenopus tropicalis

Alignment Length:305 Identity:80/306 (26%)
Similarity:124/306 (41%) Gaps:75/306 (25%)


  Fly    21 RAAYAAAEQED---PDPDQEQDRGRESPIGSLECAPTLSSRKRQLS--RFHPYHGSNIQLGDDAT 80
            :||.|....|.   |.|..| |.|       |...|........||  |||..||:|..:.:...
 Frog   607 QAAQATIMDESDALPLPGDE-DEG-------LALTPGTPCALLSLSDLRFHHLHGANALITNGGR 663

  Fly    81 VAYR---RASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLTELAPNVIRTSSEGLPHF 142
            ...|   |:.|.||:..|.|||..|::|.:.|:|:...|||.:..|:|.:.|..:.     .|: 
 Frog   664 TVLRKNSRSEFNDAIVMSSRPLRDGEMFEIVIQKMVDRWSGSIEAGVTAIRPEDLE-----FPN- 722

  Fly   143 ALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDATHVRTPRGLLPKRLLRPA 207
            .:.|:..  ::|:...:..    .||.|.:          ||                       
 Frog   723 TMTDIDY--DTWMLSGTAI----MQDGNTL----------RN----------------------- 748

  Fly   208 MGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPVSRDIPLNRAPLFVVIDVYG 272
             ..|.|.|.|  ..|||||:  :.|:    :|:||:.|||.|:|.....:|:.| .::.|||:||
 Frog   749 -NYGCDLDSL--GAGSRIGM--MKTI----RGDLHYFINGEDQGVACTGLPMGR-DIYAVIDLYG 803

  Fly   273 TTKQIRIIQLEGILSLQSACRNVILESFAEDAISELPLPESIKRF 317
            ...|:.:....|::....:..:|..:|..    |:.|:|....||
 Frog   804 QCVQVSLTGGSGLVDNSLSASHVTDKSLP----SQSPVPSVSHRF 844

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 59/219 (27%)
SOCS_SOCS_like 283..321 CDD:239687 8/36 (22%)
neurl4NP_001090721.1 SPRY_NHR_like 3..165 CDD:293945
NEUZ 5..123 CDD:128856
NEUZ 249..370 CDD:128856
SPRY_NHR_like 253..415 CDD:293945
NEUZ 449..572 CDD:128856
SPRY_NHR_like 453..613 CDD:293945 3/6 (50%)
NEUZ 645..766 CDD:128856 42/171 (25%)
SPRY_NHR_like 647..811 CDD:293945 59/219 (27%)
SPRY_NHR_like 843..1008 CDD:293945 2/3 (67%)
NEUZ 843..966 CDD:128856 2/3 (67%)
NEUZ 1049..1164 CDD:128856
SPRY_NHR_like 1050..1209 CDD:293945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D491552at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.