DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and neurl1

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001090706.1 Gene:neurl1 / 100036686 XenbaseID:XB-GENE-954449 Length:555 Species:Xenopus tropicalis


Alignment Length:238 Identity:56/238 - (23%)
Similarity:88/238 - (36%) Gaps:75/238 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GSLECAPTLSSRKRQLSRFHPY-HGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIE 110
            |.|...|.|         |||: .||.|.:........|:|||.:|:|||.||:...:...::|.
 Frog    39 GGLVITPLL---------FHPHAKGSQIIMDTSQKAVKRQASFCNAITFSNRPVVIHEQVRLKIT 94

  Fly   111 KIERGWSGHMRLGLTELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEP 175
            |.:..|||.:|||.|...|:  |.:.:.||.:|.|||.:....|                     
 Frog    95 KKQCCWSGALRLGFTSKDPS--RINPDTLPKYACPDLVSQSGFW--------------------- 136

  Fly   176 ETDDAPHRNLLGDATHVRTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGE 240
                                ...||:..       .|:.:|:         ..:|     |.||.
 Frog   137 --------------------AKALPEEF-------ANEGNII---------AFWV-----DKKGR 160

  Fly   241 LHFIINGVDRGPVSRDIPLNRAPLFVVIDVYGTTKQIRIIQLE 283
            :.:.:|..........:.:.. ||:.:|||||.|:.:.::..|
 Frog   161 VFYRVNDFGSMLFFSGVRITE-PLWALIDVYGLTRGVELLDSE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 51/216 (24%)
SOCS_SOCS_like 283..321 CDD:239687 1/1 (100%)
neurl1NP_001090706.1 NEUZ 44..166 CDD:128856 44/194 (23%)
Neuralized 277..427 CDD:369249
mRING-HC-C3HC5_NEU1A 500..543 CDD:319699
modified RING-HC finger (C3HC5-type) 502..541 CDD:319699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.