DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mmp1 and Bsph2

DIOPT Version :10

Sequence 1:NP_726473.2 Gene:Mmp1 / 37949 FlyBaseID:FBgn0035049 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001074411.1 Gene:Bsph2 / 77684 MGIID:1924934 Length:131 Species:Mus musculus


Alignment Length:55 Identity:16/55 - (29%)
Similarity:26/55 - (47%) Gaps:9/55 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 VYPKEISEGF--TGIPDHLDAAMVWGGNGKIYFFKGSKFWRFDPAKRPPVKASYP 433
            |:|...::||  :.|..|.|    :......:.|:|.  ||:..|:.|| |..:|
Mouse    41 VFPFVYADGFHYSCISLHSD----YDWCSLDFQFQGR--WRYCTAQDPP-KCIFP 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mmp1NP_726473.2 PG_binding_1 32..88 CDD:460223
Peptidase_M10 115..268 CDD:425668
HX 298..493 CDD:238046 16/55 (29%)
Bsph2NP_001074411.1 FN2 40..77 CDD:471955 11/41 (27%)
fn2 85..126 CDD:459645 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.