DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck and ACDO1

DIOPT Version :8

Sequence 1:NP_001286851.1 Gene:Adck / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_194867.2 Gene:ACDO1 / 829266 AraportID:AT4G31390 Length:682 Species:Arabidopsis thaliana

Alignment Length:333 Identity:94/334 (28%)
Similarity:148/334 (44%) Gaps:36/334 (11%)


  Fly    28 YDPNSLGIVRLSRSAAAVVD-----VALTYKRELYYKEWDKETPEYKAEK-SRVHKIAAEKLLQL 86
            |.|.::. .::..|..|||.     |.:.:...||   |...|.::...: ..|....|.:|..|
plant   113 YSPETVR-SKVLESRGAVVSLVSRGVEIVWTLGLY---WSTLTYDFLVGRDEEVVPFRARQLRNL 173

  Fly    87 ICINKGVYIKVGQHIGALEYLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSFE 151
            :|.....:||.||.:.....::.::::..:.:|..|.|..|.|..:.:|.::|....|.||....
plant   174 LCNLGPSFIKAGQVLANRPDIIREDYMNELCILQDDVPPFPNEVAFNIIEEELGQPLENIFSKIS 238

  Fly   152 REPLGTASLAQVHKARLK-TGELVAVKVQHPYVKGNSRVDMKTMELAVNVLARIFPDFKIHWL-- 213
            .:.:..|||.||::|.|: |||.||:|||.|.::.....|:    .....||.....|.:..|  
plant   239 SQTIAAASLGQVYRATLRATGEDVAIKVQRPQIEPIIYRDL----FLFRTLASFLNGFSLQKLGC 299

  Fly   214 -----VEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEGGHVT 273
                 |:|..:.|..|||:..|.||.|...:.||....:::|.:|......||||||:::|...|
plant   300 NAELIVDEFGEKLLEELDYTLEARNIEDFLENFKDDPTVKIPGVYKNLCGPRVLVMEWIDGIRCT 364

  Fly   274 DLDYIRRNKID-----SFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDHG 333
            |...|:...||     :..|:..:.||     ...|..|.|||||||...:..    .|..:|.|
plant   365 DPQAIKDAGIDLNGFLTVGVSAALRQL-----LEFGLFHGDPHPGNIFAMQDG----RIAYVDFG 420

  Fly   334 LYANLTDK 341
            ..|.|:.:
plant   421 NVAVLSQQ 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdckNP_001286851.1 AarF 34..447 CDD:223733 92/328 (28%)
ADCK1-like 118..369 CDD:270871 74/238 (31%)
ACDO1NP_194867.2 AarF 166..593 CDD:223733 82/277 (30%)
ABC1_ADCK3-like 206..452 CDD:270691 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D790106at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.