DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and ACDO1

DIOPT Version :9

Sequence 1:NP_611947.2 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_194867.2 Gene:ACDO1 / 829266 AraportID:AT4G31390 Length:682 Species:Arabidopsis thaliana


Alignment Length:333 Identity:94/333 - (28%)
Similarity:148/333 - (44%) Gaps:36/333 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YDPNSLGIVRLSRSAAAVVD-----VALTYKRELYYKEWDKETPEYKAEK-SRVHKIAAEKLLQL 86
            |.|.::. .::..|..|||.     |.:.:...||   |...|.::...: ..|....|.:|..|
plant   113 YSPETVR-SKVLESRGAVVSLVSRGVEIVWTLGLY---WSTLTYDFLVGRDEEVVPFRARQLRNL 173

  Fly    87 ICINKGVYIKVGQHIGALEYLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSFE 151
            :|.....:||.||.:.....::.::::..:.:|..|.|..|.|..:.:|.::|....|.||....
plant   174 LCNLGPSFIKAGQVLANRPDIIREDYMNELCILQDDVPPFPNEVAFNIIEEELGQPLENIFSKIS 238

  Fly   152 REPLGTASLAQVHKARLK-TGELVAVKVQHPYVKGNSRVDMKTMELAVNVLARIFPDFKIHWL-- 213
            .:.:..|||.||::|.|: |||.||:|||.|.::.....|:    .....||.....|.:..|  
plant   239 SQTIAAASLGQVYRATLRATGEDVAIKVQRPQIEPIIYRDL----FLFRTLASFLNGFSLQKLGC 299

  Fly   214 -----VEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEGGHVT 273
                 |:|..:.|..|||:..|.||.|...:.||....:::|.:|......||||||:::|...|
plant   300 NAELIVDEFGEKLLEELDYTLEARNIEDFLENFKDDPTVKIPGVYKNLCGPRVLVMEWIDGIRCT 364

  Fly   274 DLDYIRRNKID-----SFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDHG 333
            |...|:...||     :..|:..:.||     ...|..|.|||||||...:..    .|..:|.|
plant   365 DPQAIKDAGIDLNGFLTVGVSAALRQL-----LEFGLFHGDPHPGNIFAMQDG----RIAYVDFG 420

  Fly   334 LYANLTDK 341
            ..|.|:.:
plant   421 NVAVLSQQ 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_611947.2 ADCK1-like 118..369 CDD:270871 74/237 (31%)
ACDO1NP_194867.2 AarF 130..578 CDD:440425 89/315 (28%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.