DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck and coq8b

DIOPT Version :8

Sequence 1:NP_001286851.1 Gene:Adck / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_021322006.1 Gene:coq8b / 799071 ZFINID:ZDB-GENE-060503-803 Length:656 Species:Danio rerio

Alignment Length:431 Identity:97/432 (22%)
Similarity:175/432 (41%) Gaps:96/432 (22%)


  Fly    12 VGAG---LASAGW------------SLHTNDYDPNSLGIVRLS-----RSAAAVVDVALTYKREL 56
            |||.   :..|||            |.|...:..:|: :.|||     |:..|..::|...:::|
Zfish   141 VGAATGTIKGAGWPAQNTRFLHVSASQHHFRFVHDSI-VARLSPEDIQRAREAKQNIARPVRQKL 204

  Fly    57 YYKEWDKETPEYKAEKSRVHKIA------------------------------------------ 79
                 ::...|.|...:|:.::|                                          
Zfish   205 -----NERAKERKVPATRISRLANFGGLAVGLGIGAIAEVAKQSFGGKRSEVGALLDSPLLSEAN 264

  Fly    80 AEKLLQLICINKGVYIKVGQHIGALE--YLLPKEFVQTMKV---LHSDAPQNPIEDLYKVIRQDL 139
            ||:::..:|..:|..:|:||.:...:  ::.|    |..|:   :...|...|...::||:.::|
Zfish   265 AERIVNTLCKVRGAALKIGQMLSIQDNSFINP----QLQKIFERVRQSADFMPAWQMHKVLEEEL 325

  Fly   140 HCNPEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHPYVKGNSRVD----MKTMELAVNV 200
            .....|...|.|.:|...||:.|||...|..|:.:|:|:|:|.|..:...|    |..::::|.:
Zfish   326 GSGWREKLSSIEEKPFAAASIGQVHHGVLPGGKEIAMKIQYPGVAESIHSDINNLMSVLKMSVVL 390

  Fly   201 LARIFPDFKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVME 265
            ...:|.|..:    |..::.|..|.|:..|.:.|::.....|......||:::.:.|:.||:.||
Zfish   391 PDGLFADSSL----EVLQRELAWECDYEREAKCAKRFRNLLKGDPVFVVPEVFDELSARRVITME 451

  Fly   266 YLEG---GHVTDLDYIRRNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEI 327
            .:.|   ....|||...||:|     ...|.||....:|...|:.:||:..|... .:.:|  :|
Zfish   452 LVNGVPLDRCVDLDQETRNEI-----CFNILQLCLRELFEFRFMQTDPNWSNFFY-NSEQN--KI 508

  Fly   328 VLLDHGLYANLTDKFRYDYSNLWLSILKVDRKAMRQHSEQL 368
            .|||.|...:..:.|...|..:..:....||..:.:.|:.|
Zfish   509 FLLDFGACRDYPELFTDHYIEVVHAASVGDRATVLKKSKDL 549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdckNP_001286851.1 AarF 34..447 CDD:223733 88/395 (22%)
ADCK1-like 118..369 CDD:270871 67/262 (26%)
coq8bXP_021322006.1 ABC1_ADCK3 300..550 CDD:270872 68/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.