DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck and Coq8b

DIOPT Version :8

Sequence 1:NP_001286851.1 Gene:Adck / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_598531.2 Gene:Coq8b / 76889 MGIID:1924139 Length:533 Species:Mus musculus

Alignment Length:352 Identity:88/353 (25%)
Similarity:163/353 (46%) Gaps:52/353 (15%)


  Fly    80 AEKLLQLICINKGVYIKVGQHIGALE--YLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCN 142
            ||:::|.:|..:|..:|:||.:...:  ::.| :..:..:.:...|...|...:.:|:.::|..:
Mouse   140 AERIVQTLCTVRGAALKIGQMLSIQDNSFISP-QLQRIFERVRQSADFMPRWQMMRVLEEELGKD 203

  Fly   143 PEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHPYVKGNSRVDMKT----MELAVNVLAR 203
            .::...|.|..|...||:.|||:..||.|..||||:|:|.|..:.:.|::.    ::::|.:...
Mouse   204 WQDKVASLEEVPFAAASIGQVHQGLLKDGTEVAVKIQYPGVAQSIQSDVENLLALLKMSVGLPEG 268

  Fly   204 IFPDFKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLE 268
            :|.:..:..|.:|    |..|.|:..|...|:...|......:.|||.:..:..::|||.|| |.
Mouse   269 LFAEQSLQTLQQE----LAWECDYCREAACAQTFRKLLADDPFFRVPAVVQELCTTRVLGME-LA 328

  Fly   269 GGHVTD----LDYIRRNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVL 329
            ||...|    |....||:|     ..::.:|....:|...|:.:||:..|.|.   ..:|.::.|
Mouse   329 GGIPLDQCQGLSQDIRNQI-----CFQLLRLCLRELFEFRFMQTDPNWANFLY---DASSHQVTL 385

  Fly   330 LDHGLYANLTDKFRYDYSNLWLSILKV----DRKAMRQHSEQL----GIKGDLYG---LFACMVT 383
            ||.|    .:..|..::::.::.::|.    ||..:.|.|:.|    |.:...:.   :.|.|:.
Mouse   386 LDFG----ASRAFGTEFTDHYIEVVKAAADGDRDRVLQKSQDLKFLTGFETKAFSDAHVEAVMIL 446

  Fly   384 GRPW-----------ETV--MQGLTKV 397
            |.|:           ||.  :|||..|
Mouse   447 GEPFAASGPYDFGAGETARRIQGLIPV 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdckNP_001286851.1 AarF 34..447 CDD:223733 88/353 (25%)
ADCK1-like 118..369 CDD:270871 68/267 (25%)
Coq8bNP_598531.2 AarF 135..513 CDD:223733 88/353 (25%)
KxGQ motif. {ECO:0000250|UniProtKB:Q8NI60} 156..159 2/3 (67%)
ABC1_ADCK3 176..425 CDD:270872 68/266 (26%)
AAAS motif. {ECO:0000250|UniProtKB:Q8NI60} 217..220 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.