DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and CNB1

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_012731.1 Gene:CNB1 SGDID:S000001673 Length:175 Species:Saccharomyces cerevisiae

Alignment Length:185 Identity:42/186 (23%)
Similarity:76/186 (41%) Gaps:44/186 (24%)


  Fly    22 KDIARLAKDSIFSHNELISIVMLYHKFVLVNG------PRAKYMTIQQLSA--LMELLFEIVDRD 78
            |.:..|.:|:.|..:|   |..|..:|:.::.      .:.::|:|..:|:  |...:.|:.|.|
Yeast     7 KIVDGLLEDTNFDRDE---IERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGRIMEVFDAD 68

  Fly    79 LIATIVYRIAHTPGSRPPDFFSDKHIHLESFV---RLFTVYFTKDLQLKMEFAFSVYD-KSDSKQ 139
                         .|...||        :.|:   .:|:...:||  .|:.|||.:|| ..|...
Yeast    69 -------------NSGDVDF--------QEFITGLSIFSGRGSKD--EKLRFAFKIYDIDKDGFI 110

  Fly   140 LNGEQVGFFVGKFFESED-EDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVV 193
            .|||.  |.|.|.....: :||.::..:|   ...::.|.|.|..:..:|:...:
Yeast   111 SNGEL--FIVLKIMVGSNLDDEQLQQIVD---RTIVENDSDGDGRLSFEEFKNAI 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CNB1NP_012731.1 FRQ1 4..161 CDD:227455 42/186 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.