DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and Cib1

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_112407.1 Gene:Cib1 RGDID:620133 Length:191 Species:Rattus norvegicus

Alignment Length:196 Identity:41/197 (21%)
Similarity:83/197 (42%) Gaps:31/197 (16%)


  Fly    25 ARLAKDSIFSHNELI-----SIVMLYHKFVLVNGPRAK--------YMTIQQLSALMELLFEIVD 76
            :||:|:.:..:.:|.     .|::.:.:|..:..|..:        .::.:|:.:|.||......
  Rat     6 SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHTRVSFEQILSLPELKANPFK 70

  Fly    77 RDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYF-TKDLQLKMEFAFSVYDKSDSKQL 140
            ..:  .:|:..:.|..|          :..|.|:.|.:|:. |....:|..:||.::|..|...|
  Rat    71 ERI--CMVFSTSPTRDS----------LSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTL 123

  Fly   141 NGEQVGFFVGKFFESEDEDESIELRLDMKEM---LFLKFDLDKDTNIGVDEYYEVVRRQPMLLEC 202
            :.|.:...| .....|.||..:... :||::   :..:.|:|:|..|.:.|:..|:.|.|.....
  Rat   124 DREDLSRLV-NCLTGEGEDTRLSAS-EMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASS 186

  Fly   203 F 203
            |
  Rat   187 F 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Cib1NP_112407.1 EF-hand_7 109..177 CDD:290234 18/70 (26%)
EFh 111..178 CDD:238008 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.