DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and Cib4

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_082759.1 Gene:Cib4 MGIID:1920509 Length:185 Species:Mus musculus

Alignment Length:188 Identity:41/189 (22%)
Similarity:81/189 (43%) Gaps:27/189 (14%)


  Fly    22 KDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKY-----MTIQQLSALMELLFEIVDRDLIA 81
            :|:......:..:.||::.|    |...|...|..|:     :|:.|:|:|..|..... ||.|.
Mouse    12 EDLEEYQALTFLTRNEILCI----HDTFLKLCPSGKHYKEATLTMDQVSSLPALRVNPF-RDRIC 71

  Fly    82 TIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDL-QLKMEFAFSVYDKSDSKQLNGEQV 145
            .:              |..|.....|..:.:.:|:..:.. .||:|:||.:||.:::..::.|.:
Mouse    72 RV--------------FSHDNVFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDL 122

  Fly   146 GFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECF 203
            ...|.:..:|:|..|  :|.:|:...:..:.|||.|:.:...|:...:.:.|..:..|
Mouse   123 EEIVLRLLKSDDASE--DLLMDVMHHVLSESDLDNDSMLSFSEFEHAMAKSPDFMNSF 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Cib4NP_082759.1 FRQ1 21..173 CDD:227455 39/173 (23%)
EFh 101..169 CDD:238008 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.