DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and Tescl

DIOPT Version :8

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001157282.1 Gene:Tescl / 69301 MGIID:1916551 Length:231 Species:Mus musculus

Alignment Length:119 Identity:27/120 (23%)
Similarity:49/120 (41%) Gaps:24/120 (20%)


  Fly   107 ESFVRLFTVYFTKDLQLKMEFAFSVYDKSD-SKQLNG--EQVGF----FVGKFFE----SEDEDE 160
            |||..:..:.|.   .::.....:.:|..: .|..:|  |::.|    .:..:|.    |.:::|
Mouse    58 ESFDNILDLEFN---PIRSRIVRAFFDNRNLGKGTSGLAEEITFQDFLTIISYFRPLRPSLNKEE 119

  Fly   161 SIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECFGRVFPPNPQME 214
            :.:.|.|....||..:|.|.|..|.:.||..||.          .:...:||:|
Mouse   120 AEQNRKDKMRFLFNMYDQDGDGIITLQEYRRVVE----------SLLSAHPQVE 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
TesclNP_001157282.1 FRQ1 24..>155 CDD:227455 24/110 (22%)
EFh 127..>155 CDD:298682 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.