DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and CHP2

DIOPT Version :8

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_071380.1 Gene:CHP2 / 63928 HGNCID:24927 Length:196 Species:Homo sapiens

Alignment Length:169 Identity:34/170 (20%)
Similarity:56/170 (33%) Gaps:68/170 (40%)


  Fly    40 SIVMLYHKFVLVNGPRAKY---MTIQQLSALMELLFEIVDRDLIATIVYRIAHTPGSRPPDFFSD 101
            |::.|:|:|..::..:..|   |.:||:.||  .:..:.||.:                ..||.|
Human    27 SLLRLHHRFRALDRNKKGYLSRMDLQQIGAL--AVNPLGDRII----------------ESFFPD 73

  Fly   102 --KHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGFFVGKFFESEDED----- 159
              :.:....|||:                                    :..|...||||     
Human    74 GSQRVDFPGFVRV------------------------------------LAHFRPVEDEDTETQD 102

  Fly   160 ----ESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVR 194
                |.:..|.:.....|..:|||:|..|...|..:|:|
Human   103 PKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLR 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CHP2NP_071380.1 FRQ1 16..179 CDD:227455 34/170 (20%)
Nuclear export signal 137..148 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.