DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and Tesc

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_067319.2 Gene:Tesc MGIID:1930803 Length:214 Species:Mus musculus

Alignment Length:169 Identity:39/170 (23%)
Similarity:63/170 (37%) Gaps:41/170 (24%)


  Fly    78 DLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQL-----KMEFAFSVYDKSDS 137
            |.|..:..|.....|.:|.       |..|:|..:      .||:|     |:..||     .|:
Mouse    23 DQIEQLHRRFKQLSGDQPT-------IRKENFNNV------PDLELNPIRSKIVRAF-----FDN 69

  Fly   138 KQLN------GEQVGF----FVGKFFESEDE---DESIEL-RLDMKEMLFLKFDLDKDTNIGVDE 188
            :.|.      .:::.|    .:..:|...|.   :|.:|| |.:..:.||..:|.|.|..|.::|
Mouse    70 RNLRKGSSGLADEINFEDFLTIMSYFRPIDTTLGEEQVELSRKEKLKFLFHMYDSDSDGRITLEE 134

  Fly   189 YYEVVRR----QPMLLECFGRVFPPNPQMEVLALCANVM 223
            |..||..    .|.:.:...|.......||..::|...|
Mouse   135 YRNVVEELLSGNPHIEKESARSIADGAMMEAASVCVGQM 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
TescNP_067319.2 FRQ1 20..>142 CDD:227455 33/137 (24%)
EFh 114..>142 CDD:298682 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.