DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and ppp3r1a

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_009305321.1 Gene:ppp3r1a ZFINID:ZDB-GENE-081113-3 Length:175 Species:Danio rerio

Alignment Length:164 Identity:39/165 (24%)
Similarity:70/165 (42%) Gaps:24/165 (15%)


  Fly    33 FSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIAHTPGSRPPD 97
            |..:|:..:...:.|..|.|   :..:::::..:|.||     .::.:...|..|..|.|:...|
Zfish    20 FDADEIKRLGKRFKKLDLDN---SGSLSVEEFMSLPEL-----QQNPLVQRVIDIFDTDGNGEVD 76

  Fly    98 FFSDKHIHLESFVRLFTVYFTK-DLQLKMEFAFSVYD-KSDSKQLNGEQVGFFVGKFFESED-ED 159
            |        :.|:...:.:..| |.::|:.|||.:|| ..|....|||.  |.|.|.....: :|
Zfish    77 F--------KEFIEGVSQFSVKGDKEMKLRFAFRIYDMDKDGYISNGEL--FQVLKMMVGNNLKD 131

  Fly   160 ESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVV 193
            ..::..:|   ...:..|.|.|..|..:|:..||
Zfish   132 TQLQQIVD---KTIINADKDGDGRISFEEFCAVV 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
ppp3r1aXP_009305321.1 FRQ1 14..162 CDD:227455 38/163 (23%)
EFh 30..85 CDD:238008 13/71 (18%)
EFh 96..162 CDD:238008 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.