DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and Chp1

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_062743.1 Gene:Chp1 MGIID:1927185 Length:195 Species:Mus musculus

Alignment Length:181 Identity:40/182 (22%)
Similarity:68/182 (37%) Gaps:60/182 (33%)


  Fly    22 KDIARLAKDSIFSHNELISIVMLYHKFVLV----NG--PRAKYMTIQQLSALMELLFEIVDRDLI 80
            :::..:.|::.|||::   |..||.:|..:    ||  .|..:..|.:|:     :..:.||.:.
Mouse    12 EELEEIKKETGFSHSQ---ITRLYSRFTSLDKGENGTLSREDFQRIPELA-----INPLGDRIIN 68

  Fly    81 ATIVYRIAHTPGSRPPDFFS--DKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGE 143
            |                |||  :..::...|:|.. .:|.           .:.|...||.:|| 
Mouse    69 A----------------FFSEGEDQVNFRGFMRTL-AHFR-----------PIEDNEKSKDVNG- 104

  Fly   144 QVGFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVR 194
                           .|.:..|.:.....|..:|||||..|..||..:|:|
Mouse   105 ---------------PEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLR 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Chp1NP_062743.1 FRQ1 1..182 CDD:227455 40/182 (22%)
Necessary for association with microtubule and interaction with GAPDH. {ECO:0000250} 2..6
Nuclear export signal 1. {ECO:0000250} 138..147 2/4 (50%)
Nuclear export signal 2. {ECO:0000250} 176..185
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.