DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and efcab1

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001038325.1 Gene:efcab1 / 558421 ZFINID:ZDB-GENE-040914-40 Length:216 Species:Danio rerio


Alignment Length:196 Identity:46/196 - (23%)
Similarity:82/196 - (41%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FSHNELISIVMLYHKFV--------LVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIAH 89
            |:..|...::.|::..:        .:...|||:..|      :...|.:.| |::...|.|:. 
Zfish    26 FNKTETECLIRLFNSLLGEQAERKTTIGVDRAKFRNI------LHHTFGMTD-DMMTDRVCRVI- 82

  Fly    90 TPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGFFV-GKFF 153
                   |..:|.::.::.:|...:|:....|..||::.|.|||      |||:  |:.. .:.|
Zfish    83 -------DKDNDGYLSVKEWVEALSVFLRGTLDEKMKYCFEVYD------LNGD--GYISREEMF 132

  Fly   154 E-----------SEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECFGRVF 207
            :           .||.||.|:   |:.|:...|.|.|.|..:...::.:.|..:.:|||.||...
Zfish   133 QMLKDSLIRQPTEEDPDEGIK---DIVEIALKKMDYDHDGRVSYADFEKTVMDENLLLEAFGNCL 194

  Fly   208 P 208
            |
Zfish   195 P 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
efcab1NP_001038325.1 EFh 80..136 CDD:238008 17/71 (24%)
EF-hand_7 80..135 CDD:290234 17/70 (24%)
EFh 110..176 CDD:238008 22/76 (29%)
EF-hand_7 111..178 CDD:290234 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.