DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and PPP3R2

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_671709.2 Gene:PPP3R2 HGNCID:9318 Length:170 Species:Homo sapiens

Alignment Length:165 Identity:45/166 (27%)
Similarity:74/166 (45%) Gaps:23/166 (14%)


  Fly    34 SHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIAHTPGSRPPDF 98
            ||.:...|..|..:|..::..::..:::::..:|.||....:.|.:|     .:..|.|....||
Human    13 SHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVI-----DVFDTDGDGEVDF 72

  Fly    99 FSDKHIHLESFVRLFTVYFT--KDLQLKMEFAFSVYD-KSDSKQLNGEQVGFFVGKFFESED-ED 159
                    :.|: |.|..|:  .|.:.|:.||||:|| ..|....|||.  |.|.|.....: .|
Human    73 --------KEFI-LGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGEL--FQVLKMMVGNNLTD 126

  Fly   160 ESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVR 194
            ..::..:| |.::.|  |.|.|..|..:|:..|||
Human   127 WQLQQLVD-KTIIIL--DKDGDGKISFEEFSAVVR 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
PPP3R2NP_671709.2 FRQ1 13..159 CDD:227455 45/166 (27%)
Calcineurin A binding. {ECO:0000250|UniProtKB:P63098} 131..136 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.