DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and CanB

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001245531.1 Gene:CanB FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster

Alignment Length:171 Identity:42/172 (24%)
Similarity:74/172 (43%) Gaps:34/172 (20%)


  Fly    31 SIFSHNELISIVMLYHKFVLVNGPRA---KYMTIQQL--SALMELLFEIVDRDLIATIVYRIAHT 90
            |.|..:|:..:...:.|..|.|....   ::|::.:|  :.|::.:.:|.|.|            
  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDAD------------ 65

  Fly    91 PGSRPPDFFSDKHIHLESFVRLFTVYFTK-DLQLKMEFAFSVYD-KSDSKQLNGEQVGFFVGKFF 153
             |:...||        :.|::..:.:..: |...|:.|||.:|| .:|....|||.  |.|.|..
  Fly    66 -GNGEVDF--------KEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGEL--FQVLKMM 119

  Fly   154 ESED-EDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVV 193
            ...: :|..::..:| |.:.|.  |.|:|..|..||:..||
  Fly   120 VGNNLKDTQLQQIVD-KTICFA--DKDEDGKISFDEFCSVV 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 40/167 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.