DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and CG15177

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_649672.1 Gene:CG15177 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster

Alignment Length:230 Identity:83/231 (36%)
Similarity:133/231 (58%) Gaps:21/231 (9%)


  Fly     1 MKDLDGSLDTLENARFNYVYMKDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLS 65
            |::||.::|:.||::|:.:|...|..:|..|..|..::..::.:|:|||..|||.||.|...|..
  Fly     1 MENLDSTVDSTENSKFSALYGGLIKEIAATSKMSTLDITCLLCVYYKFVRFNGPGAKQMKKNQFY 65

  Fly    66 ALMELLF-----EIVDRDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKM 125
            .:..:||     ::::|.|:|...               ..|::...::|.||.:|.|:||:.:|
  Fly    66 QIYLVLFNVANVQVIERSLLAITK---------------DTKYVSPRAWVDLFELYTTEDLERRM 115

  Fly   126 EFAFSVYDKSDSKQLNGEQVGFFVGKFF-ESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEY 189
            :|||.|||..::..::.||||....||| |.:||||.||||.||.|.:..|||:|||..|..::|
  Fly   116 KFAFEVYDTKNTGVIDREQVGVACEKFFHEGDDEDELIELRADMTEFIMKKFDVDKDGVISFEDY 180

  Fly   190 YEVVRRQPMLLECFGRVFPPNPQMEVLALCANVMS 224
            ..||.:||:|:|..|.:||.|.:.:::|...|:.|
  Fly   181 SSVVSQQPVLVEFLGWLFPSNEERDLMAHVINMDS 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CG15177NP_649672.1 EF-hand_7 115..180 CDD:290234 33/65 (51%)
EFh 116..179 CDD:298682 32/63 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1686816
eggNOG 1 0.900 E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23055
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.