DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and tescb

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_991256.1 Gene:tescb ZFINID:ZDB-GENE-040426-1903 Length:216 Species:Danio rerio

Alignment Length:89 Identity:23/90 (26%)
Similarity:41/90 (46%) Gaps:14/90 (16%)


  Fly   119 KDLQ---LKMEFAFSVYDKSD-SKQLNG--EQVGF----FVGKFFESE----DEDESIELRLDMK 169
            :||:   ::.:...:.:||.: .|...|  :::||    .|..:|.:.    .|::..|:|....
Zfish    53 QDLESNPIRSQIIEAFFDKRNFQKDATGSVQEIGFEEFLTVMSYFRAPAHQITEEQREEIRRAKL 117

  Fly   170 EMLFLKFDLDKDTNIGVDEYYEVV 193
            ..||...|.|.|..|.::||..||
Zfish   118 RFLFNMHDTDNDGTITLEEYRHVV 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
tescbNP_991256.1 FRQ1 14..>144 CDD:227455 23/90 (26%)
EFh 116..>144 CDD:298682 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.