DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and Nca

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_788543.1 Gene:Nca FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster

Alignment Length:201 Identity:40/202 (20%)
Similarity:89/202 (44%) Gaps:29/202 (14%)


  Fly    12 ENARFNYVYMKDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVD 76
            :|::.....::|   |.:::.|:..|    :..::|..|.:.| :.::::::...:....|...|
  Fly     4 QNSKLKPEVLED---LKQNTEFTDAE----IQEWYKGFLKDCP-SGHLSVEEFKKIYGNFFPYGD 60

  Fly    77 RDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLN 141
            ....|..|:|.....|....||        ..|:...:|.....|:.|:::|||:||...:..::
  Fly    61 ASKFAEHVFRTFDANGDGTIDF--------REFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYIS 117

  Fly   142 GEQ-------VGFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQP-- 197
            .::       :...||...:..:::.:.|.|.|   .:|.:.|.:||..:.::|:.|..:..|  
  Fly   118 RQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTD---KIFRQMDRNKDGKLSLEEFIEGAKSDPSI 179

  Fly   198 -MLLEC 202
             .||:|
  Fly   180 VRLLQC 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
NcaNP_788543.1 FRQ1 13..179 CDD:227455 36/185 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91187229
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23055
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.