DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and Frq1

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001033853.1 Gene:Frq1 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster

Alignment Length:185 Identity:45/186 (24%)
Similarity:86/186 (46%) Gaps:24/186 (13%)


  Fly    24 IARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIA 88
            |.||..|:.|:..|    :..:||..|.:.|.. .:|.|....:.:..|...|....|::|:|:.
  Fly    13 IDRLTTDTYFTEKE----IRQWHKGFLKDCPNG-LLTEQGFIKIYKQFFPQGDPSKFASLVFRVF 72

  Fly    89 HTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQ-------VG 146
                    |..:|..|..|.|:|..:|....:|..|:::||.:||..:...:..|:       :.
  Fly    73 --------DENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIY 129

  Fly   147 FFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLE 201
            ..||:..:||||: :.:.|:|   .:|.:.|.:.|..:.::|:.|..:..|.:::
  Fly   130 QMVGQQPQSEDEN-TPQKRVD---KIFDQMDKNHDGKLTLEEFREGSKADPRIVQ 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 45/182 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C90544165
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23055
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.