DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and Ppp3r2

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_067733.1 Gene:Ppp3r2 RGDID:69232 Length:176 Species:Rattus norvegicus

Alignment Length:165 Identity:44/166 (27%)
Similarity:74/166 (45%) Gaps:24/166 (14%)


  Fly    33 FSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIAHTPGSRPPD 97
            |.|:|   |..|...|..::..::..:::.:..:|.||    ....|:..:: .|..|.|:...|
  Rat    15 FDHDE---IKRLGRSFKKMDLDKSGSLSVDEFMSLPEL----QQNPLVGRVI-DIFDTDGNGEVD 71

  Fly    98 FFSDKHIHLESFVRLFTVYFTK-DLQLKMEFAFSVYD-KSDSKQLNGEQVGFFVGKFFESED-ED 159
            |        ..|:...:.:..| |.:.|:.|||.:|| .:|....|||.  |.|.|.....: :|
  Rat    72 F--------REFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGEL--FQVLKMMVGNNLKD 126

  Fly   160 ESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVR 194
            ..::..:| |.:|.|  |.|.|..|..:|:.:|||
  Rat   127 WQLQQLVD-KSILVL--DKDGDGRISFEEFRDVVR 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Ppp3r2NP_067733.1 PTZ00184 11..153 CDD:185504 41/159 (26%)
EFh 27..76 CDD:238008 11/62 (18%)
EFh 91..158 CDD:238008 25/72 (35%)
Calcineurin A binding. {ECO:0000250|UniProtKB:P63098} 131..136 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.