DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and chpf-2

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_503830.2 Gene:chpf-2 / 186617 WormBaseID:WBGene00019108 Length:195 Species:Caenorhabditis elegans


Alignment Length:180 Identity:34/180 - (18%)
Similarity:67/180 - (37%) Gaps:50/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IVMLYHKFVLV--NG----PRAKYMTIQQLSA------LMELLFEIVDRDLIATIVYRIAHTPGS 93
            |:.||.:|..:  ||    .|..::.:.:|:.      :::..|.:.|.|             |.
 Worm    28 ILRLYTRFASLDKNGQGYLSRDDFLNVPELAVNPLGDRIIDAFFTLGDSD-------------GD 79

  Fly    94 RPPDFFSDKHIHLESFVRLFT----VYFTKDLQL-----KMEFAFSVYDKSDSKQLNGEQ----V 145
            .     ....:....|||:..    :...||..|     |:.|||.:||.:.:..:..|:    :
 Worm    80 S-----KSGQLTFRQFVRILAHFQPISKVKDNALNSRKDKLRFAFKMYDLNKNNYITREEFKVIL 139

  Fly   146 GFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRR 195
            ...||....|:..|:..:..|:       :.|.|:|..|..:::...:.:
 Worm   140 NSMVGANITSDQLDKIADKTLE-------EADQDRDGKISFEDFCRAMEK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
chpf-2NP_503830.2 FRQ1 15..182 CDD:227455 34/178 (19%)
EFh 35..95 CDD:298682 12/77 (16%)
EFh 114..180 CDD:238008 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.