DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3565 and CIB1

Sequence 1:NP_611942.1 Gene:CG3565 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_006720438.1 Gene:CIB1 HGNCID:16920 Length:264 Species:Homo sapiens

Alignment Length:253 Identity:52/254 (20%)
Similarity:95/254 (37%) Gaps:53/254 (21%)


  Fly    25 ARLAKDSIFSHNELI-----SIVMLYHKFV---------LVNGPRAKYMTIQQLSALMELLFEIV 75
            :||:|:.:..:.:|.     .|::.:.:|.         :.:..||: :..:|:.:|.||...  
Human     6 SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQ-VPFEQILSLPELKAN-- 67

  Fly    76 DRDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYF-TKDLQLKMEFAFSVYDKSDSKQ 139
                  ....||.....:.|    :...:..|.|:.|.:|:. |....:|..:||.::|..|...
Human    68 ------PFKERICRVFSTSP----AKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGT 122

  Fly   140 LNGEQVGFFVGKFFESEDEDESIELRLDMKEM---LFLKFDLDKDTNIGVDEYYEVVRRQPMLLE 201
            ||.|.:...| .....|.||..:... :||::   :..:.|:|:|..|.:.|:..|:.|.|    
Human   123 LNREDLSRLV-NCLTGEGEDTRLSAS-EMKQLIDNILEESDIDRDGTINLSEFQHVISRSP---- 181

  Fly   202 CFGRV--------FPPNPQMEVLALCANVMSWFDDSPNP--------RIMIKPDGGKA 243
            .|.|.        .|....:..|.|......|......|        ::.:.|..|.|
Human   182 DFARYDSGPPSFWVPAGSDLLPLGLGHGYRRWCQGERKPQSPHTGPAKLAVSPRAGAA 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CIB1XP_006720438.1 EF-hand_8 82..132 CDD:290545 13/50 (26%)
EF-hand_7 109..177 CDD:290234 19/70 (27%)
EFh 111..178 CDD:238008 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.