DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ITP and C05E11.6

Sequence 1:NP_001036569.2 Gene:ITP FlyBaseID:FBgn0035023 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_508782.2 Gene:C05E11.6 WormBaseID:WBGene00015495 Length:152 Species:Caenorhabditis elegans

Alignment Length:113 Identity:27/114 (24%)
Similarity:44/114 (39%) Gaps:31/114 (27%)


  Fly     5 NIKISVVLFLVLIPIFAALPHNH--------NLSKRSNFFDLECKGIFN---------------- 45
            |.|.:.:..||||.:..:|...|        |..||........:.||.                
 Worm     4 NFKTAYLSLLVLILVLISLTDAHASSWKSILNSDKRMETKQHSLESIFRVRRTYIDENENCGSHE 68

  Fly    46 -KTMFFRLDRICEDCYQL----FRETSIHRLCKANCFVHETFGDCLKV 88
             :.:...:||||..|::|    ...|.:.  |:.:||.::||..|:|:
 Worm    69 LEMVHTIMDRICMLCHELRSHFAPNTRVE--CRKDCFQNDTFQSCMKI 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ITPNP_001036569.2 Crust_neurohorm 37..104 CDD:279488 16/74 (22%)
C05E11.6NP_508782.2 Crust_neurohorm <76..>114 CDD:279488 14/40 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139731349
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR35981
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.990

Return to query results.
Submit another query.