DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KEL and Nepl11

Sequence 1:XP_005250050.1 Gene:KEL HGNCID:6308 Length:744 Species:Homo sapiens
Sequence 2:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster

Alignment Length:713 Identity:140/714 (20%)
Similarity:232/714 (32%) Gaps:240/714 (34%)


Human   106 NTSVAPCTDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDT 170
            :||..||.||:.:.|..:       ..|:...:.|.:.:|:..:.......|.:...|:.||   
  Fly    40 DTSKQPCQDFYGYVCSHS-------ANLSETGRQRFQSLLKETDVAQLMDMELQLINFFKSC--- 94

Human   171 LAIEAAGTGPLRQVIEELGG---WRISGKWTSLNFNRTLRLLMSQYGHFPFFRAYLGPHPASPHT 232
                .:|.|     :|.|.|   :|.||.|.||..|:.                     .||..|
  Fly    95 ----ESGRG-----VEALKGSQLYRQSGGWPSLEPNKV---------------------NASQRT 129

Human   233 PVIQIDQPEFDVPLKQDQEQKIYAQIFREYLTYLNQLGTLLGGDPSKVQEHSSLSISI----TSR 293
                            :|.|:     :...|.|.:::|.....:.|...:.:...:.:    |.|
  Fly   130 ----------------NQTQR-----WLGLLGYFHEVGAPYFFETSVTMQSNKRLVVLQPDGTRR 173

Human   294 LFQFLRPLEQRRAQGKLFQMVTIDQLKEMAPAIDWLSCLQATFTPMSLSPSQSLVVHDVEYLKNM 358
              ..||..|||  .|::.|...|:|.:....|::.|          ||..|:..:|       ..
  Fly   174 --NTLRKFEQR--VGEVLQSFGIEQSRAHVTALEVL----------SLERSRRDIV-------KA 217

Human   359 SQLVEEMLLKQRDFLQSHMILGLVVTLSPALDSQFQEARRKLSQKLRELTEQPPMPARPRWMKCV 423
            ..:.:::.....:|  ..::.|....:....|..|   |:.|..|..:.::...:...||     
  Fly   218 DHVEDQVQFSYGNF--KRIVFGNASLIRLDWDGYF---RKLLGGKTPQASDTIVVKQLPR----- 272

Human   424 EETGTFFEPTLAALFVREAFGPSTRSAAMKLFTAIRDALITRLRNLPWMN-------------EE 475
                                       .::.|..:::..:.||.|..|.:             .|
  Fly   273 ---------------------------LVEYFALLQNTSMVRLLNWIWTDYLMDIVDADCHQLSE 310

Human   476 T----------QNMAQDKVAQLQV----------EMGASEWALKPELARQE-------------- 506
            |          |.:..::|...|:          ::|.|.|.  .|::||.              
  Fly   311 TYAGDLYAHVVQRVTANRVELAQMYSELGKAYTDQLGGSVWI--DEISRQSSRQFLGNIMHTTLN 373

Human   507 --------YNDIQLGSSFLQSVLSCVRSLR--ARIVQSFLQPHPQHRWKVSPWDVNAYYSVSDHV 561
                    |:.|.||...|...|..:|..:  .|:.....|...::....:|  |||:  :..|.
  Fly   374 GDERLDAAYHSILLGRRSLYRNLEKLRKFQRTRRLASHSAQQVRRYAQMFAP--VNAF--LGQHN 434

Human   562 VVFPAG-LLQPPFFHPGYPRAVNFGAAGSIMAHELLHIFYQLLLPGGCLACDNHALQEAHLCLKR 625
            :..|.. ||...||      :.:..||||....:           |...:.|:          :|
  Fly   435 LSTPLNYLLLGEFF------SRSLVAAGSSSRTQ-----------GAWRSSDS----------ER 472

Human   626 HYAAFP--LPSRTSFNDSLTFLENAADVGGLA--IALQAYSKRLLRHHG-----ETVLP--SLDL 679
            .:|.|.  :..:|:..|.|..|        ||  .||.||.:.|....|     :.||.  |..:
  Fly   473 RFAIFQQCVGKQTNAIDLLLSL--------LAQRQALSAYGQWLATQAGLVERVDAVLAAGSSKM 529

Human   680 SPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLRVHGPLSSTPAFARYFRCARGALLNP-SSRC 741
            |.|::||.:...|.||........|.....   .|..|.::|.|...|||..|.:|.| ..||
  Fly   530 SLQRLFFVTSLLVDCRSELGALQQDRKRQV---THATLRNSPEFLEAFRCRPGDVLYPQDQRC 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KELXP_005250050.1 PepO 106..744 CDD:226118 140/714 (20%)
M13 109..742 CDD:189000 138/711 (19%)
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 137/707 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.