DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT2G33435

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001318342.1 Gene:AT2G33435 / 817909 AraportID:AT2G33435 Length:1325 Species:Arabidopsis thaliana


Alignment Length:185 Identity:36/185 - (19%)
Similarity:82/185 - (44%) Gaps:38/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFS----------VFGN--ILNCNVAKDEDGNSRGYGFVHFDSEEAA 166
            ::|.:|:..|...|::.:.|:          :.|:  .::|.:.|:     :....|.|.:.:.|
plant   879 RLYAENVPDSASEKSLIECFNGYMLSSGSNHIKGSEPCISCIINKE-----KSQALVEFLTPQDA 938

  Fly   167 RAAIEKVNGMLC----NNQKVHVVK-FIPRRDREQEKATHFKN------------LYVKNLSEEF 214
            .||: .::|  |    :|.|:...| ::...:.|.||.....|            :::...|:..
plant   939 SAAL-SLDG--CSFAGSNLKIRRPKDYVRTTNGELEKKEPAANAVSDNVEDSSNKIFIGGFSKAI 1000

  Fly   215 TEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLG 269
            :.:.|.|:...:|.:.:::.:.:.: .::|..|:.|.:....|.|..||:|.:||
plant  1001 SSEMLMEIVSVFGPLKAYRFVSNND-LNQRCAFLEYTDGSVTLKACAGLNGMRLG 1054

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/85 (20%)
RRM3_I_PABPs 202..282 CDD:240826 15/80 (19%)
AT2G33435NP_001318342.1 PTZ00121 <3..783 CDD:173412
U2AF_lg 681..1137 CDD:273727 36/185 (19%)
RRM_SF <1275..1311 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.