DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT2G22100

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_565526.1 Gene:AT2G22100 / 816745 AraportID:AT2G22100 Length:382 Species:Arabidopsis thaliana


Alignment Length:169 Identity:41/169 - (24%)
Similarity:76/169 - (44%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SPDSGKIYIKNLERSID-NKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEK 172
            ||...|...|..:||.| ::.:.|:..|...|:  .:..|.|        ..||.|:        
plant    75 SPKKSKESKKKHKRSSDESEEIVDSKPVTVPIV--TIESDSD--------FEFDKED-------- 121

  Fly   173 VNGMLCNNQKVHVVKFIPR---------------RDREQEKATHFKNLYVKNLSEEFTEQHLREM 222
            :..:|.:..|..::..|.:               .||:..:    :|::|:.|..:.|.::|:..
plant   122 IKNLLESYSKEELINLIYKTAEKGSKLISAVFESADRDSSQ----RNIFVRGLGWDTTHENLKAA 182

  Fly   223 FEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAV 260
            ||.||.||...:::|:: ||::.||||.::..:.|.||:
plant   183 FEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAAL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 14/70 (20%)
RRM3_I_PABPs 202..282 CDD:240826 21/60 (35%)
AT2G22100NP_565526.1 PABP-1234 <164..>353 CDD:130689 21/58 (36%)
RRM_SF 165..235 CDD:418427 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.