DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AgaP_AGAP002374

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_563821.4 Gene:AgaP_AGAP002374 / 3290608 VectorBaseID:AGAP002374 Length:362 Species:Anopheles gambiae


Alignment Length:198 Identity:57/198 - (28%)
Similarity:99/198 - (50%) Gaps:22/198 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHF------DSEEAARAAIE 171
            |::|..|:....:..:...|..:|.:::..|.|| :...|||:||:.:      |..:|:|.  .
Mosquito    30 KLFIGGLDYRTTDDTLKAYFEKWGKVVDVVVMKDPKTKRSRGFGFITYSKSYMIDDAQASRP--H 92

  Fly   172 KVNGMLCNNQKVHVVKFIPRRD-REQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLM 235
            |::|.:     |...:.:||:| ...|..:..|.|:|..|.::|.|:||||.|..||.:.|..::
Mosquito    93 KIDGRV-----VEPKRAVPRQDINRPEAGSSVKKLFVGGLRDDFDEEHLREYFSKYGNVISACIV 152

  Fly   236 LDEE-GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQ 299
            .|:: |:.|.||||.::: ...:..:| |.......||.|.|.:||.|    |:::|...:..|.
Mosquito   153 TDKDNGKKRGFGFVEFDD-YDPVDKII-LQKSHTIQNKLLDVKKALPK----QDMDRYKNDMGRT 211

  Fly   300 KAG 302
            ..|
Mosquito   212 GGG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/76 (24%)
RRM3_I_PABPs 202..282 CDD:240826 29/80 (36%)
AgaP_AGAP002374XP_563821.4 RRM1_hnRNPA_like 30..107 CDD:241022 19/83 (23%)
RRM2_hnRNPA_like 121..193 CDD:240774 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.