DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3483 and CG7755

Sequence 1:NP_611912.1 Gene:CG3483 FlyBaseID:FBgn0035005 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster

Alignment Length:387 Identity:85/388 (22%)
Similarity:160/388 (41%) Gaps:55/388 (14%)


  Fly    15 SVGGAYRLFAGKDQKKDSAGQKTRQPEKPPQDKQKSKGASGKAKSAGSTDSAKKTTKVTLINGEG 79
            ||..||   |..|.:.|           |.....|||        .|..::....|..|:|..:|
  Fly    27 SVRAAY---AKGDARAD-----------PVNVLPKSK--------YGGINTVSLVTGTTIIGQQG 69

  Fly    80 VGRELMDAVQEVICAVKAPIEWDVHDEFKAKDSDDVSPEVLKSLRANKVGIKGPVDSRHWQRQIR 144
            .     ..|..::.:.:.|:|..|   .:|...|:....||::..|..|..:...:::....:|.
  Fly    70 A-----QFVSSLLSSSRVPVEVQV---IEAGQDDEYFHSVLRNRTAVHVDNQADAEAKQKALKIC 126

  Fly   145 KQFAQFAYVSLCSHIEGLDSPYGDFDVVIIRDQMEGDYSGIEHLVVPGVMQTIKVSTTAGAARIA 209
            .....:.:.:......|....:...|:.:|.....|.::.:|:..|.||::.:.|.:..|..:..
  Fly   127 NDLDLYVFKTRTRSFPGFKCRFPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYL 191

  Fly   210 EFVFNYAVKNKRKRITVAHKANIMRMTDGNFLEAMRAEADKHVDDVLFEERYLDTCILKILLKPH 274
            .:.|..|.|..|||:|:.:||....::||:.:||.:.....:.|.:..|...::..|.:::.:|.
  Fly   192 RYAFKAAAKAGRKRVTLINKAKEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPT 256

  Fly   275 KCDVMVSSSMYGDVLRVIAGGMMGVPGICPGYSVSSLGTVFDCRMKACHA--------LAGKDLA 331
            ..|.:.:|..|...|..|..      |:|.|.::.|...:.|     .||        |:..:.|
  Fly   257 YFDCLFASERYATFLSAICS------GVCGGANLFSAVEIGD-----HHAVFKPLQTKLSLTNYA 310

  Fly   332 NPT--GPLLSAALMLRHVKMDKQADQVDCAIRKVYKDTDIRTPDVGGKAKCSEFVKAVCDCL 391
            |.:  |.:.:...:.:|:..||.||.:.|.:::. .|..|||.:.||: ...|:|  :|:.:
  Fly   311 NLSAYGIVSTIVDLFQHLGHDKCADALWCELKRT-MDEGIRTKEFGGQ-DTGEYV--ICNII 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3483NP_611912.1 Iso_dh 71..389 CDD:294303 72/328 (22%)
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 74/342 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C57950589
eggNOG 1 0.900 E1_COG0473
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S361
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11835
RoundUp 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.